Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VRX3

Protein Details
Accession A0A423VRX3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
108-130ASSPAPKRGRGRPKKNVAPPTAPHydrophilic
NLS Segment(s)
PositionSequence
94-123PKRKRKNADTAAAAASSPAPKRGRGRPKKN
Subcellular Location(s) cyto 13, nucl 6, mito 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MSSPSKDIIATYGLTPRDVDIAIKALITMIDGNLKPDYDKLAKLAGFKDGVAANKGWWATRKKIMSAKGANGDDDADDADNDNDDITSAPASTPKRKRKNADTAAAAASSPAPKRGRGRPKKNVAPPTAPAATAQEGGAEVDGQAGVDMVEGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.16
5 0.15
6 0.15
7 0.11
8 0.13
9 0.13
10 0.12
11 0.11
12 0.09
13 0.09
14 0.09
15 0.08
16 0.05
17 0.1
18 0.1
19 0.13
20 0.13
21 0.13
22 0.13
23 0.14
24 0.19
25 0.16
26 0.17
27 0.16
28 0.2
29 0.21
30 0.23
31 0.23
32 0.2
33 0.18
34 0.17
35 0.18
36 0.15
37 0.15
38 0.15
39 0.14
40 0.11
41 0.13
42 0.14
43 0.12
44 0.16
45 0.19
46 0.22
47 0.28
48 0.3
49 0.32
50 0.37
51 0.41
52 0.44
53 0.43
54 0.42
55 0.41
56 0.39
57 0.35
58 0.3
59 0.26
60 0.17
61 0.14
62 0.11
63 0.05
64 0.04
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.09
78 0.12
79 0.21
80 0.3
81 0.41
82 0.51
83 0.59
84 0.66
85 0.71
86 0.8
87 0.79
88 0.76
89 0.69
90 0.61
91 0.54
92 0.47
93 0.37
94 0.26
95 0.19
96 0.15
97 0.12
98 0.16
99 0.16
100 0.21
101 0.27
102 0.37
103 0.47
104 0.56
105 0.66
106 0.7
107 0.8
108 0.85
109 0.89
110 0.88
111 0.83
112 0.78
113 0.7
114 0.66
115 0.57
116 0.47
117 0.38
118 0.32
119 0.27
120 0.22
121 0.2
122 0.13
123 0.12
124 0.12
125 0.12
126 0.08
127 0.06
128 0.06
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04