Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VX92

Protein Details
Accession A0A423VX92   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-48TKNARKKLSDLTRKPCNRNGGGRVKLPKRCSKRRTVDRREQNDLIHydrophilic
NLS Segment(s)
PositionSequence
26-32RVKLPKR
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MPLTKNARKKLSDLTRKPCNRNGGGRVKLPKRCSKRRTVDRREQNDLITPKAAMYRLIREMAGNHKDIRFSNCALKAIHELAEDYLISRFEGGCSIPISPCYASNIPTAANLCAHHGQRITVMQTEPRLPELILSVLGQYENGMNYKPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.79
4 0.82
5 0.78
6 0.76
7 0.71
8 0.71
9 0.71
10 0.7
11 0.67
12 0.67
13 0.7
14 0.69
15 0.69
16 0.68
17 0.69
18 0.69
19 0.74
20 0.75
21 0.76
22 0.79
23 0.83
24 0.87
25 0.87
26 0.88
27 0.88
28 0.88
29 0.85
30 0.76
31 0.66
32 0.63
33 0.54
34 0.45
35 0.35
36 0.27
37 0.2
38 0.2
39 0.19
40 0.14
41 0.14
42 0.16
43 0.18
44 0.18
45 0.18
46 0.16
47 0.18
48 0.22
49 0.23
50 0.21
51 0.2
52 0.2
53 0.21
54 0.22
55 0.25
56 0.2
57 0.19
58 0.23
59 0.23
60 0.24
61 0.23
62 0.23
63 0.21
64 0.19
65 0.18
66 0.13
67 0.12
68 0.1
69 0.1
70 0.09
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.08
84 0.09
85 0.11
86 0.11
87 0.11
88 0.15
89 0.15
90 0.16
91 0.17
92 0.17
93 0.15
94 0.16
95 0.17
96 0.13
97 0.14
98 0.12
99 0.15
100 0.19
101 0.19
102 0.21
103 0.2
104 0.2
105 0.21
106 0.23
107 0.22
108 0.2
109 0.2
110 0.21
111 0.23
112 0.26
113 0.25
114 0.24
115 0.23
116 0.19
117 0.19
118 0.18
119 0.16
120 0.14
121 0.13
122 0.11
123 0.1
124 0.1
125 0.1
126 0.08
127 0.08
128 0.09
129 0.1