Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JS11

Protein Details
Accession G8JS11    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
23-42SLPRRPLKKIRLGKSRPAIYHydrophilic
NLS Segment(s)
PositionSequence
27-35RPLKKIRLG
162-171LATKKKKAKK
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG erc:Ecym_3445  -  
Amino Acid Sequences MFRFIAVKRFASTGGYHGSNQISLPRRPLKKIRLGKSRPAIYYQFDVKVELSDGSVITRRSQIPKDQIRLIQDQRNNPLWNESRTDLMVVDANAGGRMEKFKQKYGSIYTVAQGSKVDEAEASESVSAASEPSKEESEEFGMDDYLSLLSENAVQVQSGGKLATKKKKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.24
5 0.24
6 0.22
7 0.21
8 0.25
9 0.25
10 0.25
11 0.33
12 0.39
13 0.42
14 0.49
15 0.58
16 0.59
17 0.64
18 0.72
19 0.74
20 0.76
21 0.78
22 0.8
23 0.8
24 0.77
25 0.68
26 0.64
27 0.57
28 0.49
29 0.48
30 0.41
31 0.35
32 0.29
33 0.28
34 0.24
35 0.21
36 0.19
37 0.14
38 0.11
39 0.09
40 0.08
41 0.08
42 0.11
43 0.1
44 0.11
45 0.14
46 0.16
47 0.2
48 0.23
49 0.28
50 0.35
51 0.41
52 0.44
53 0.45
54 0.45
55 0.44
56 0.48
57 0.46
58 0.42
59 0.4
60 0.39
61 0.4
62 0.43
63 0.4
64 0.34
65 0.36
66 0.32
67 0.3
68 0.29
69 0.25
70 0.21
71 0.2
72 0.2
73 0.13
74 0.11
75 0.1
76 0.07
77 0.07
78 0.06
79 0.06
80 0.06
81 0.05
82 0.05
83 0.04
84 0.06
85 0.08
86 0.14
87 0.16
88 0.21
89 0.25
90 0.26
91 0.3
92 0.33
93 0.35
94 0.31
95 0.3
96 0.26
97 0.26
98 0.24
99 0.21
100 0.16
101 0.13
102 0.12
103 0.11
104 0.11
105 0.07
106 0.08
107 0.09
108 0.09
109 0.09
110 0.07
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.05
118 0.07
119 0.1
120 0.11
121 0.12
122 0.13
123 0.15
124 0.18
125 0.17
126 0.16
127 0.14
128 0.13
129 0.12
130 0.11
131 0.09
132 0.06
133 0.06
134 0.06
135 0.05
136 0.05
137 0.07
138 0.07
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.1
145 0.09
146 0.1
147 0.11
148 0.18
149 0.27
150 0.37
151 0.46