Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VKH6

Protein Details
Accession A0A423VKH6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-129VHSSIKKRCEHCKIVRRKKGKRGNGYRYVICHydrophilic
NLS Segment(s)
PositionSequence
114-121RRKKGKRG
Subcellular Location(s) mito 13.5, nucl 10.5, cyto_mito 8.333, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASRLSIARCMRNSSSLSGLANSLRTLSINAASRPTTTTTTTATVVPTQTQKTQTRALSSSILTPRCGSSCAVPAAARTNTLMATAVTGVKQQTRGMKVHSSIKKRCEHCKIVRRKKGKRGNGYRYVICPANPRHKQRQGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.33
4 0.32
5 0.26
6 0.25
7 0.21
8 0.19
9 0.16
10 0.13
11 0.11
12 0.11
13 0.11
14 0.11
15 0.14
16 0.17
17 0.17
18 0.19
19 0.2
20 0.2
21 0.21
22 0.22
23 0.2
24 0.19
25 0.2
26 0.2
27 0.21
28 0.22
29 0.2
30 0.19
31 0.17
32 0.16
33 0.16
34 0.17
35 0.17
36 0.19
37 0.25
38 0.27
39 0.29
40 0.35
41 0.34
42 0.34
43 0.34
44 0.33
45 0.28
46 0.25
47 0.26
48 0.25
49 0.24
50 0.21
51 0.2
52 0.19
53 0.18
54 0.18
55 0.14
56 0.11
57 0.13
58 0.13
59 0.13
60 0.12
61 0.12
62 0.15
63 0.15
64 0.14
65 0.11
66 0.11
67 0.1
68 0.1
69 0.1
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.08
78 0.1
79 0.12
80 0.17
81 0.2
82 0.22
83 0.24
84 0.28
85 0.3
86 0.38
87 0.43
88 0.46
89 0.49
90 0.55
91 0.6
92 0.61
93 0.67
94 0.66
95 0.69
96 0.7
97 0.75
98 0.78
99 0.81
100 0.86
101 0.88
102 0.88
103 0.9
104 0.9
105 0.9
106 0.9
107 0.9
108 0.9
109 0.89
110 0.86
111 0.79
112 0.71
113 0.66
114 0.57
115 0.48
116 0.46
117 0.44
118 0.49
119 0.54
120 0.59
121 0.65