Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423X3F7

Protein Details
Accession A0A423X3F7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-27GLKLCIFGKKAKKATREKPEQTAVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 12.833, cyto 6, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000209  Peptidase_S8/S53_dom  
IPR036852  Peptidase_S8/S53_dom_sf  
Gene Ontology GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00082  Peptidase_S8  
PROSITE View protein in PROSITE  
PS51892  SUBTILASE  
Amino Acid Sequences MCGLKLCIFGKKAKKATREKPEQTAVPTAPQEKPKTHVLVFIMLECDGRAFNNFIAQLPKEGASHNQRYEQPSLNLRGFKTALKAQYARDLRKSQIGKDAGVLGVAYFGEVLLDPTFESPSGLKPRRQTQSGQNVGLGDLWHLDAVDASPSHSVGRGEFQARDFSESFVARDEKGTTQELRDSNGQGTAVASLIGGNNVGVAKGVDIIPVKYLLSEDNTLGFSTIAKSTPMSLFESLQWVLWHVIKNEKQGKAVLNVSQGTRPSWTDGIPDPTEEEQALSDPWGHFWEALNQQDIVVVTSAGHDGESTEDAAETQSPRRLASPGAVAEQTLIVVGGSQRSASNSEELEFWPQSNSLGIVDVLAPGRDVTVARHNYNGVWRKGDGTSLSAAIASGIIAQYLGENDLHALNPGGVGRTVKGELGQIAVSGGDTGKVQVHDEEASMSERDGYGFFTQVTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.83
4 0.85
5 0.87
6 0.84
7 0.83
8 0.82
9 0.76
10 0.7
11 0.67
12 0.57
13 0.52
14 0.5
15 0.46
16 0.44
17 0.48
18 0.49
19 0.44
20 0.47
21 0.49
22 0.5
23 0.46
24 0.46
25 0.4
26 0.41
27 0.39
28 0.36
29 0.3
30 0.24
31 0.23
32 0.17
33 0.15
34 0.1
35 0.09
36 0.1
37 0.11
38 0.11
39 0.16
40 0.16
41 0.17
42 0.22
43 0.22
44 0.22
45 0.21
46 0.23
47 0.19
48 0.2
49 0.26
50 0.3
51 0.37
52 0.38
53 0.43
54 0.46
55 0.5
56 0.54
57 0.52
58 0.48
59 0.47
60 0.49
61 0.48
62 0.47
63 0.43
64 0.43
65 0.38
66 0.35
67 0.33
68 0.33
69 0.32
70 0.34
71 0.36
72 0.33
73 0.41
74 0.46
75 0.46
76 0.48
77 0.48
78 0.44
79 0.5
80 0.51
81 0.44
82 0.46
83 0.44
84 0.37
85 0.35
86 0.34
87 0.25
88 0.23
89 0.19
90 0.1
91 0.08
92 0.08
93 0.06
94 0.04
95 0.03
96 0.04
97 0.04
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.07
105 0.08
106 0.08
107 0.14
108 0.24
109 0.28
110 0.32
111 0.37
112 0.46
113 0.52
114 0.54
115 0.53
116 0.52
117 0.59
118 0.61
119 0.56
120 0.49
121 0.42
122 0.39
123 0.35
124 0.25
125 0.15
126 0.09
127 0.08
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.07
137 0.07
138 0.07
139 0.09
140 0.09
141 0.08
142 0.11
143 0.13
144 0.15
145 0.16
146 0.17
147 0.2
148 0.2
149 0.24
150 0.22
151 0.2
152 0.21
153 0.2
154 0.19
155 0.18
156 0.18
157 0.14
158 0.15
159 0.16
160 0.14
161 0.16
162 0.19
163 0.17
164 0.17
165 0.22
166 0.21
167 0.22
168 0.23
169 0.21
170 0.19
171 0.19
172 0.18
173 0.12
174 0.12
175 0.09
176 0.07
177 0.06
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.03
184 0.04
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.04
191 0.04
192 0.06
193 0.06
194 0.06
195 0.07
196 0.07
197 0.07
198 0.06
199 0.07
200 0.06
201 0.08
202 0.08
203 0.08
204 0.09
205 0.09
206 0.09
207 0.09
208 0.08
209 0.06
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.08
216 0.09
217 0.11
218 0.11
219 0.11
220 0.12
221 0.12
222 0.14
223 0.13
224 0.13
225 0.11
226 0.1
227 0.1
228 0.11
229 0.13
230 0.11
231 0.18
232 0.19
233 0.27
234 0.33
235 0.33
236 0.32
237 0.33
238 0.34
239 0.3
240 0.3
241 0.24
242 0.21
243 0.21
244 0.2
245 0.2
246 0.19
247 0.16
248 0.15
249 0.14
250 0.14
251 0.14
252 0.13
253 0.14
254 0.16
255 0.2
256 0.19
257 0.19
258 0.18
259 0.18
260 0.18
261 0.15
262 0.14
263 0.08
264 0.09
265 0.09
266 0.07
267 0.08
268 0.07
269 0.08
270 0.09
271 0.09
272 0.09
273 0.09
274 0.15
275 0.18
276 0.19
277 0.2
278 0.18
279 0.18
280 0.19
281 0.18
282 0.12
283 0.08
284 0.07
285 0.06
286 0.06
287 0.07
288 0.05
289 0.05
290 0.04
291 0.04
292 0.06
293 0.06
294 0.06
295 0.06
296 0.06
297 0.06
298 0.07
299 0.08
300 0.09
301 0.1
302 0.14
303 0.14
304 0.15
305 0.16
306 0.17
307 0.16
308 0.18
309 0.2
310 0.18
311 0.19
312 0.19
313 0.17
314 0.16
315 0.15
316 0.12
317 0.07
318 0.06
319 0.03
320 0.04
321 0.04
322 0.05
323 0.05
324 0.06
325 0.06
326 0.08
327 0.1
328 0.11
329 0.14
330 0.13
331 0.14
332 0.15
333 0.16
334 0.2
335 0.18
336 0.17
337 0.15
338 0.15
339 0.14
340 0.14
341 0.13
342 0.08
343 0.09
344 0.08
345 0.08
346 0.08
347 0.08
348 0.08
349 0.07
350 0.07
351 0.06
352 0.06
353 0.07
354 0.07
355 0.09
356 0.18
357 0.23
358 0.24
359 0.26
360 0.27
361 0.28
362 0.37
363 0.42
364 0.35
365 0.34
366 0.33
367 0.34
368 0.34
369 0.36
370 0.28
371 0.22
372 0.21
373 0.18
374 0.18
375 0.15
376 0.14
377 0.11
378 0.09
379 0.06
380 0.05
381 0.04
382 0.04
383 0.04
384 0.04
385 0.05
386 0.05
387 0.07
388 0.06
389 0.06
390 0.07
391 0.08
392 0.09
393 0.09
394 0.09
395 0.08
396 0.09
397 0.09
398 0.09
399 0.1
400 0.11
401 0.11
402 0.14
403 0.15
404 0.14
405 0.15
406 0.15
407 0.15
408 0.16
409 0.15
410 0.11
411 0.11
412 0.1
413 0.09
414 0.08
415 0.07
416 0.06
417 0.06
418 0.07
419 0.1
420 0.11
421 0.13
422 0.13
423 0.16
424 0.16
425 0.16
426 0.17
427 0.15
428 0.17
429 0.16
430 0.15
431 0.13
432 0.13
433 0.13
434 0.12
435 0.15
436 0.14
437 0.15