Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VFE3

Protein Details
Accession A0A423VFE3   
Localization Confidence High
Confidence Score 23
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPKRMTANPVKPSRHRAGKHydrophilic
38-57TSTPQPPKKRTIAPPPKVPSHydrophilic
389-436NAMPLGRRRSRSRSPRRDRDRDDHKERKREYSRERDRHDDDKRRRVDSBasic
NLS Segment(s)
PositionSequence
231-237KRLKRAR
394-434GRRRSRSRSPRRDRDRDDHKERKREYSRERDRHDDDKRRRV
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033194  MFAP1  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MPPKRMTANPVKPSRHRAGKPTGAGSDSSSSSDSEAETSTPQPPKKRTIAPPPKVPSAGRIISTSGAKPDESVKKLAAARQRAEIERKAREEGFVTEDEDDDDDDKDGAGKGGESSEESGSSEDSDEDEDESSSEEEEAPRRLMVRPKFISKAQRANPQPDPSQKEADEEAQRRADADALVEAQIQKDLAARAAGKKHWDDDSDSEAEEVDDADGVDPEAEYAAWKLRELKRLKRAREAVEAREREIAEKERRQNLTEEERAAEDEALVARQREEKEGRGKMGFMQKYYHKGAFYQDDLKTEGLDKRDLMGARFADEVKNRELLPQALQMRDMTKLGKKGATKYRDLKSEDTGSWGRFDDPRRQRDQWGQYRDGDRDGDRGGAGGQGANAMPLGRRRSRSRSPRRDRDRDDHKERKREYSRERDRHDDDKRRRVDSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.75
4 0.73
5 0.74
6 0.75
7 0.74
8 0.7
9 0.63
10 0.54
11 0.5
12 0.44
13 0.38
14 0.3
15 0.26
16 0.22
17 0.19
18 0.18
19 0.18
20 0.15
21 0.13
22 0.13
23 0.12
24 0.14
25 0.16
26 0.22
27 0.29
28 0.34
29 0.41
30 0.45
31 0.52
32 0.58
33 0.65
34 0.67
35 0.71
36 0.77
37 0.77
38 0.82
39 0.8
40 0.77
41 0.72
42 0.63
43 0.56
44 0.53
45 0.48
46 0.39
47 0.34
48 0.3
49 0.29
50 0.31
51 0.27
52 0.23
53 0.21
54 0.19
55 0.19
56 0.25
57 0.31
58 0.31
59 0.33
60 0.3
61 0.35
62 0.37
63 0.41
64 0.41
65 0.4
66 0.39
67 0.44
68 0.48
69 0.46
70 0.5
71 0.52
72 0.51
73 0.5
74 0.51
75 0.49
76 0.45
77 0.42
78 0.38
79 0.33
80 0.31
81 0.25
82 0.23
83 0.19
84 0.19
85 0.18
86 0.16
87 0.14
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.07
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.09
103 0.1
104 0.1
105 0.1
106 0.1
107 0.1
108 0.1
109 0.09
110 0.07
111 0.07
112 0.08
113 0.08
114 0.09
115 0.09
116 0.08
117 0.08
118 0.09
119 0.08
120 0.07
121 0.07
122 0.07
123 0.08
124 0.1
125 0.12
126 0.12
127 0.12
128 0.13
129 0.16
130 0.24
131 0.27
132 0.34
133 0.36
134 0.4
135 0.44
136 0.47
137 0.53
138 0.52
139 0.57
140 0.53
141 0.59
142 0.58
143 0.61
144 0.62
145 0.58
146 0.56
147 0.54
148 0.54
149 0.49
150 0.49
151 0.43
152 0.39
153 0.36
154 0.36
155 0.36
156 0.32
157 0.32
158 0.28
159 0.28
160 0.26
161 0.24
162 0.2
163 0.13
164 0.11
165 0.08
166 0.07
167 0.08
168 0.08
169 0.08
170 0.06
171 0.07
172 0.06
173 0.05
174 0.06
175 0.06
176 0.06
177 0.07
178 0.08
179 0.11
180 0.14
181 0.15
182 0.17
183 0.18
184 0.19
185 0.2
186 0.21
187 0.21
188 0.21
189 0.24
190 0.21
191 0.2
192 0.18
193 0.16
194 0.14
195 0.11
196 0.08
197 0.04
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.06
211 0.06
212 0.07
213 0.14
214 0.18
215 0.26
216 0.31
217 0.39
218 0.47
219 0.55
220 0.58
221 0.6
222 0.62
223 0.58
224 0.63
225 0.58
226 0.55
227 0.56
228 0.54
229 0.46
230 0.44
231 0.39
232 0.31
233 0.3
234 0.3
235 0.28
236 0.34
237 0.39
238 0.43
239 0.44
240 0.44
241 0.44
242 0.43
243 0.43
244 0.4
245 0.35
246 0.28
247 0.27
248 0.26
249 0.24
250 0.18
251 0.1
252 0.08
253 0.07
254 0.07
255 0.07
256 0.06
257 0.07
258 0.11
259 0.12
260 0.17
261 0.19
262 0.24
263 0.32
264 0.35
265 0.37
266 0.33
267 0.33
268 0.32
269 0.39
270 0.35
271 0.28
272 0.29
273 0.29
274 0.34
275 0.38
276 0.36
277 0.27
278 0.27
279 0.3
280 0.3
281 0.3
282 0.31
283 0.27
284 0.27
285 0.28
286 0.27
287 0.23
288 0.22
289 0.22
290 0.18
291 0.18
292 0.17
293 0.16
294 0.2
295 0.2
296 0.18
297 0.2
298 0.18
299 0.18
300 0.19
301 0.18
302 0.18
303 0.21
304 0.23
305 0.2
306 0.22
307 0.21
308 0.22
309 0.24
310 0.21
311 0.21
312 0.25
313 0.26
314 0.24
315 0.25
316 0.24
317 0.23
318 0.23
319 0.21
320 0.18
321 0.19
322 0.22
323 0.24
324 0.28
325 0.3
326 0.36
327 0.45
328 0.47
329 0.51
330 0.55
331 0.58
332 0.61
333 0.62
334 0.57
335 0.53
336 0.53
337 0.46
338 0.44
339 0.41
340 0.34
341 0.32
342 0.29
343 0.26
344 0.25
345 0.29
346 0.33
347 0.4
348 0.47
349 0.53
350 0.55
351 0.6
352 0.65
353 0.72
354 0.71
355 0.7
356 0.66
357 0.65
358 0.67
359 0.62
360 0.55
361 0.48
362 0.39
363 0.34
364 0.31
365 0.25
366 0.2
367 0.19
368 0.16
369 0.13
370 0.12
371 0.09
372 0.08
373 0.08
374 0.08
375 0.08
376 0.08
377 0.07
378 0.09
379 0.14
380 0.21
381 0.26
382 0.33
383 0.41
384 0.49
385 0.6
386 0.69
387 0.75
388 0.79
389 0.84
390 0.89
391 0.92
392 0.94
393 0.93
394 0.92
395 0.91
396 0.91
397 0.9
398 0.9
399 0.89
400 0.88
401 0.84
402 0.84
403 0.83
404 0.83
405 0.82
406 0.83
407 0.85
408 0.85
409 0.87
410 0.86
411 0.83
412 0.83
413 0.83
414 0.83
415 0.82
416 0.82
417 0.82