Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423WEX2

Protein Details
Accession A0A423WEX2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33NKESKSSSKSSHHHHKRHHDSHKSSEKDNBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MGSSNKESKSSSKSSHHHHKRHHDSHKSSEKDNNVAASSTVVSREFSFLFVVNNLVLNESLDTYLAASTDRWGNTLPPERSCDYEGEVTSTVFRWKDGRVTPLPGDYYGWSRPKGWGTQGGIWGWTVDPTTNMVVQQYMKPFETYTVFRGWRFLPVVFMGSDATTTDVNEEEPEAMYHALSFNSELGRPVSLAGPRGRLYAVGKDAGWVGRLVPESYRNPYTDVQTCRGLSGSLPLILGLMGLSQSDGRAADAFTQGLWRDRNWHGPKWAFQGKRPALCSEKARPAVGRQRADV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.76
4 0.77
5 0.8
6 0.84
7 0.86
8 0.9
9 0.9
10 0.9
11 0.86
12 0.87
13 0.88
14 0.8
15 0.74
16 0.71
17 0.65
18 0.6
19 0.55
20 0.48
21 0.38
22 0.35
23 0.31
24 0.24
25 0.2
26 0.16
27 0.15
28 0.12
29 0.12
30 0.13
31 0.15
32 0.14
33 0.14
34 0.14
35 0.13
36 0.14
37 0.13
38 0.13
39 0.11
40 0.12
41 0.11
42 0.1
43 0.1
44 0.09
45 0.09
46 0.09
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.12
57 0.12
58 0.12
59 0.13
60 0.14
61 0.21
62 0.3
63 0.3
64 0.29
65 0.34
66 0.34
67 0.36
68 0.36
69 0.31
70 0.25
71 0.26
72 0.24
73 0.22
74 0.21
75 0.18
76 0.17
77 0.16
78 0.16
79 0.13
80 0.13
81 0.12
82 0.13
83 0.19
84 0.21
85 0.27
86 0.27
87 0.31
88 0.31
89 0.32
90 0.32
91 0.26
92 0.24
93 0.19
94 0.2
95 0.2
96 0.22
97 0.21
98 0.21
99 0.23
100 0.24
101 0.25
102 0.24
103 0.26
104 0.26
105 0.28
106 0.3
107 0.27
108 0.25
109 0.23
110 0.2
111 0.13
112 0.1
113 0.07
114 0.05
115 0.05
116 0.06
117 0.07
118 0.08
119 0.08
120 0.07
121 0.08
122 0.09
123 0.11
124 0.12
125 0.13
126 0.13
127 0.13
128 0.13
129 0.13
130 0.15
131 0.14
132 0.14
133 0.18
134 0.18
135 0.18
136 0.2
137 0.19
138 0.19
139 0.19
140 0.17
141 0.13
142 0.13
143 0.14
144 0.12
145 0.12
146 0.09
147 0.07
148 0.07
149 0.06
150 0.07
151 0.05
152 0.05
153 0.06
154 0.05
155 0.06
156 0.06
157 0.06
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.05
164 0.05
165 0.06
166 0.05
167 0.05
168 0.06
169 0.06
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.08
176 0.09
177 0.1
178 0.1
179 0.14
180 0.15
181 0.17
182 0.18
183 0.18
184 0.18
185 0.17
186 0.18
187 0.19
188 0.2
189 0.17
190 0.17
191 0.16
192 0.17
193 0.16
194 0.14
195 0.1
196 0.08
197 0.1
198 0.11
199 0.11
200 0.12
201 0.17
202 0.2
203 0.25
204 0.28
205 0.25
206 0.28
207 0.29
208 0.33
209 0.35
210 0.36
211 0.34
212 0.36
213 0.36
214 0.32
215 0.31
216 0.26
217 0.19
218 0.19
219 0.17
220 0.13
221 0.13
222 0.12
223 0.11
224 0.11
225 0.1
226 0.06
227 0.04
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.05
234 0.06
235 0.06
236 0.07
237 0.08
238 0.1
239 0.11
240 0.11
241 0.1
242 0.13
243 0.14
244 0.18
245 0.19
246 0.18
247 0.23
248 0.27
249 0.38
250 0.4
251 0.46
252 0.5
253 0.53
254 0.58
255 0.61
256 0.66
257 0.59
258 0.59
259 0.63
260 0.62
261 0.64
262 0.62
263 0.59
264 0.54
265 0.57
266 0.59
267 0.57
268 0.59
269 0.56
270 0.56
271 0.52
272 0.57
273 0.61
274 0.63