Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LY40

Protein Details
Accession E2LY40    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
182-226DDISSSGKSKRKRSPKRKERRKRKLSKERRAKEKKKYANLSDDERBasic
NLS Segment(s)
PositionSequence
188-240GKSKRKRSPKRKERRKRKLSKERRAKEKKKYANLSDDERAARRISSSHGRKGR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
KEGG mpr:MPER_12218  -  
Amino Acid Sequences MDAYTGRGTGEDMDYDIDRRTIFGSVHHGYYRSPFEDPAPSKSLGADISNKDPWVKPSRPWRERPDIPVLSSSSDEEDTHLENKEKSSGNVQGEESEDDSVKVPVDKGKTRDFKGSDLVADMNDEDITPEMQQTVLDAFKGAMRYDKFKGPIMSYMSEEIPGIKQGPAETDKVENPAEKELDDISSSGKSKRKRSPKRKERRKRKLSKERRAKEKKKYANLSDDERAARRISSSHGRKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.14
5 0.13
6 0.13
7 0.13
8 0.13
9 0.13
10 0.14
11 0.21
12 0.22
13 0.26
14 0.26
15 0.26
16 0.24
17 0.29
18 0.31
19 0.26
20 0.25
21 0.23
22 0.24
23 0.33
24 0.35
25 0.36
26 0.35
27 0.33
28 0.32
29 0.31
30 0.3
31 0.22
32 0.22
33 0.22
34 0.21
35 0.25
36 0.26
37 0.27
38 0.27
39 0.27
40 0.3
41 0.33
42 0.32
43 0.34
44 0.44
45 0.55
46 0.6
47 0.67
48 0.69
49 0.71
50 0.73
51 0.73
52 0.72
53 0.63
54 0.57
55 0.52
56 0.44
57 0.36
58 0.31
59 0.26
60 0.18
61 0.16
62 0.15
63 0.13
64 0.13
65 0.13
66 0.14
67 0.15
68 0.15
69 0.14
70 0.15
71 0.19
72 0.18
73 0.17
74 0.2
75 0.24
76 0.25
77 0.26
78 0.25
79 0.21
80 0.22
81 0.22
82 0.18
83 0.13
84 0.11
85 0.09
86 0.1
87 0.09
88 0.08
89 0.07
90 0.07
91 0.1
92 0.14
93 0.17
94 0.2
95 0.28
96 0.34
97 0.35
98 0.41
99 0.4
100 0.37
101 0.37
102 0.34
103 0.26
104 0.21
105 0.19
106 0.12
107 0.11
108 0.09
109 0.06
110 0.05
111 0.05
112 0.04
113 0.04
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.07
127 0.08
128 0.07
129 0.11
130 0.12
131 0.16
132 0.19
133 0.22
134 0.23
135 0.26
136 0.28
137 0.25
138 0.28
139 0.28
140 0.27
141 0.24
142 0.24
143 0.2
144 0.19
145 0.17
146 0.13
147 0.1
148 0.1
149 0.1
150 0.08
151 0.09
152 0.08
153 0.12
154 0.14
155 0.15
156 0.15
157 0.17
158 0.17
159 0.2
160 0.21
161 0.19
162 0.18
163 0.2
164 0.2
165 0.17
166 0.17
167 0.15
168 0.15
169 0.14
170 0.12
171 0.1
172 0.13
173 0.14
174 0.18
175 0.23
176 0.29
177 0.38
178 0.48
179 0.58
180 0.66
181 0.76
182 0.83
183 0.88
184 0.93
185 0.95
186 0.97
187 0.97
188 0.97
189 0.97
190 0.96
191 0.97
192 0.97
193 0.96
194 0.96
195 0.96
196 0.94
197 0.94
198 0.95
199 0.93
200 0.93
201 0.92
202 0.92
203 0.91
204 0.91
205 0.87
206 0.86
207 0.81
208 0.77
209 0.71
210 0.65
211 0.58
212 0.51
213 0.45
214 0.37
215 0.32
216 0.26
217 0.23
218 0.25
219 0.32
220 0.38