Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423X942

Protein Details
Accession A0A423X942    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
180-205YEKIQEKKTSGKKAHYKKVMARRQKGBasic
NLS Segment(s)
PositionSequence
55-65KAGKEKKTEKK
182-205KIQEKKTSGKKAHYKKVMARRQKG
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MAATFSDQDIDRLLSAAEASLAEKASSQAVAIKSKQQSLVAPAKAPAFAPAADGKAGKEKKTEKKEELTLRVPQLKIKDKKAVPDNAGAAWNNMPRTRIEDPKVKREFQLLRLRGVLDPKKHFKKDTRKDPFPQYSQMGTLIEAPLDYHSGRVPRRERKRTLVEEVLSTGAKDDKFKTRYEKIQEKKTSGKKAHYKKVMARRQKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.07
5 0.06
6 0.06
7 0.07
8 0.08
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.08
15 0.12
16 0.14
17 0.19
18 0.2
19 0.27
20 0.29
21 0.32
22 0.33
23 0.31
24 0.29
25 0.32
26 0.39
27 0.33
28 0.31
29 0.3
30 0.29
31 0.27
32 0.26
33 0.2
34 0.14
35 0.12
36 0.14
37 0.13
38 0.13
39 0.14
40 0.14
41 0.13
42 0.2
43 0.22
44 0.21
45 0.27
46 0.34
47 0.43
48 0.53
49 0.6
50 0.56
51 0.6
52 0.67
53 0.68
54 0.66
55 0.6
56 0.55
57 0.52
58 0.52
59 0.46
60 0.4
61 0.4
62 0.43
63 0.44
64 0.45
65 0.48
66 0.45
67 0.52
68 0.56
69 0.54
70 0.47
71 0.45
72 0.41
73 0.33
74 0.33
75 0.26
76 0.2
77 0.16
78 0.16
79 0.13
80 0.13
81 0.13
82 0.11
83 0.17
84 0.2
85 0.24
86 0.26
87 0.33
88 0.36
89 0.45
90 0.49
91 0.44
92 0.41
93 0.42
94 0.41
95 0.42
96 0.48
97 0.4
98 0.37
99 0.37
100 0.38
101 0.32
102 0.36
103 0.32
104 0.27
105 0.32
106 0.39
107 0.46
108 0.47
109 0.51
110 0.54
111 0.6
112 0.65
113 0.71
114 0.72
115 0.71
116 0.74
117 0.8
118 0.78
119 0.7
120 0.64
121 0.56
122 0.47
123 0.41
124 0.37
125 0.27
126 0.2
127 0.18
128 0.13
129 0.1
130 0.08
131 0.08
132 0.07
133 0.08
134 0.08
135 0.07
136 0.09
137 0.15
138 0.18
139 0.26
140 0.34
141 0.43
142 0.54
143 0.62
144 0.67
145 0.7
146 0.78
147 0.77
148 0.76
149 0.73
150 0.64
151 0.56
152 0.51
153 0.44
154 0.34
155 0.26
156 0.2
157 0.15
158 0.15
159 0.16
160 0.18
161 0.25
162 0.28
163 0.32
164 0.4
165 0.44
166 0.52
167 0.59
168 0.66
169 0.65
170 0.74
171 0.77
172 0.75
173 0.78
174 0.78
175 0.79
176 0.75
177 0.77
178 0.77
179 0.79
180 0.84
181 0.83
182 0.82
183 0.81
184 0.85
185 0.85