Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423W286

Protein Details
Accession A0A423W286    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLNKDVQSYRLVTVATLVDRLKINGSLARRCLKDLEERGQIRPVVTHSKMQIYTRALGAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.14
21 0.14
22 0.12
23 0.12
24 0.15
25 0.2
26 0.2
27 0.23
28 0.25
29 0.26
30 0.3
31 0.3
32 0.27
33 0.23
34 0.22
35 0.18
36 0.16
37 0.14
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.17
50 0.21
51 0.26
52 0.26
53 0.26
54 0.27
55 0.27
56 0.33
57 0.35
58 0.37
59 0.41
60 0.43
61 0.43
62 0.46
63 0.44
64 0.35
65 0.31
66 0.29
67 0.28
68 0.29
69 0.32
70 0.3
71 0.36
72 0.38
73 0.39
74 0.41
75 0.37
76 0.37
77 0.33