Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423WT72

Protein Details
Accession A0A423WT72    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
128-153NPNPIAKTKTPRKSAKKVKQQAESDAHydrophilic
NLS Segment(s)
PositionSequence
87-112SGGSRAARAPKTPASGKAKAKGKKRP
138-144PRKSAKK
Subcellular Location(s) nucl 17, cyto 5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSSKWNDTSVKDLTFAVIMSSNDGNVNIKANWDRVEQLMQNWGYDFTKGAMSQQWTKKILKEFRQRHPDTAGNGDNSSAPATPANKSGGSRAARAPKTPASGKAKAKGKKRPAAEDDDEGDSPIGGFNPNPIAKTKTPRKSAKKVKQQAESDAESVAESEEADEDADVVKQPKSEEKDEDYHFTFDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.15
4 0.13
5 0.12
6 0.14
7 0.14
8 0.13
9 0.13
10 0.14
11 0.14
12 0.12
13 0.15
14 0.12
15 0.16
16 0.18
17 0.2
18 0.21
19 0.21
20 0.22
21 0.21
22 0.26
23 0.23
24 0.22
25 0.26
26 0.24
27 0.23
28 0.22
29 0.22
30 0.17
31 0.17
32 0.16
33 0.1
34 0.12
35 0.12
36 0.12
37 0.14
38 0.17
39 0.25
40 0.29
41 0.35
42 0.36
43 0.37
44 0.4
45 0.46
46 0.5
47 0.52
48 0.58
49 0.6
50 0.66
51 0.75
52 0.73
53 0.67
54 0.64
55 0.58
56 0.5
57 0.48
58 0.41
59 0.32
60 0.29
61 0.27
62 0.21
63 0.18
64 0.16
65 0.1
66 0.08
67 0.08
68 0.09
69 0.1
70 0.12
71 0.13
72 0.13
73 0.14
74 0.15
75 0.2
76 0.2
77 0.21
78 0.23
79 0.29
80 0.29
81 0.29
82 0.31
83 0.27
84 0.29
85 0.29
86 0.32
87 0.32
88 0.38
89 0.4
90 0.44
91 0.5
92 0.52
93 0.58
94 0.6
95 0.62
96 0.62
97 0.63
98 0.63
99 0.6
100 0.62
101 0.57
102 0.51
103 0.44
104 0.4
105 0.36
106 0.29
107 0.24
108 0.16
109 0.12
110 0.09
111 0.07
112 0.04
113 0.04
114 0.05
115 0.11
116 0.12
117 0.13
118 0.15
119 0.2
120 0.24
121 0.33
122 0.42
123 0.45
124 0.54
125 0.63
126 0.71
127 0.76
128 0.84
129 0.85
130 0.86
131 0.87
132 0.86
133 0.86
134 0.8
135 0.77
136 0.71
137 0.64
138 0.53
139 0.44
140 0.35
141 0.26
142 0.22
143 0.15
144 0.09
145 0.06
146 0.05
147 0.05
148 0.06
149 0.06
150 0.05
151 0.05
152 0.06
153 0.06
154 0.08
155 0.09
156 0.1
157 0.12
158 0.14
159 0.22
160 0.28
161 0.33
162 0.37
163 0.41
164 0.48
165 0.5
166 0.55
167 0.5