Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423W6Z0

Protein Details
Accession A0A423W6Z0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
282-308NAIPPMESKKKRRARKKQNVESLKEGGHydrophilic
NLS Segment(s)
PositionSequence
289-298SKKKRRARKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.833, mito_nucl 10.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002125  CMP_dCMP_dom  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF00383  dCMP_cyt_deam_1  
Amino Acid Sequences MKSDQYLNLCLEQAALSPLHYRHGCVVVKGGKVIGQGFNDCRPGYDGGSVLKTGVLPKSATSLDDNPDKLDPPRSKGDFKTVESIIGNCGGGGHANARLTMHSEMMAIKSALSSRSTLATNTVSRVKPCFKLPGDSKHKRALRRDAVVAYAEAVCLATFEQEFDQGAAHAQADEWRHYYQTPKQQCNGYKSNNNKKYNVKVDKKLQNATTVSSTTGKNVETHSASVPDAKEGNTGRFGLRKARGKQLVIPKGRMGSSSSTVQDRMKHPKLVGADVYVARLVNAIPPMESKKKRRARKKQNVESLKEGGIDACSTAFNLPPSTGSLHDELIRKEVQPQPPFTIHEDVQDHPAPAESRPCYRCVAYMHSVGIKRVFWTTNEGKWECAKVRDLIDQLDGTMQNETDTSLGLPVPEVFVTKHEVLLLRRLMSGQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.15
5 0.16
6 0.23
7 0.23
8 0.24
9 0.25
10 0.33
11 0.33
12 0.3
13 0.37
14 0.36
15 0.36
16 0.36
17 0.32
18 0.26
19 0.27
20 0.28
21 0.24
22 0.21
23 0.25
24 0.27
25 0.3
26 0.32
27 0.3
28 0.28
29 0.28
30 0.27
31 0.25
32 0.24
33 0.22
34 0.21
35 0.23
36 0.22
37 0.18
38 0.16
39 0.15
40 0.16
41 0.16
42 0.15
43 0.14
44 0.14
45 0.18
46 0.18
47 0.19
48 0.21
49 0.23
50 0.26
51 0.31
52 0.31
53 0.29
54 0.3
55 0.3
56 0.28
57 0.33
58 0.33
59 0.32
60 0.41
61 0.44
62 0.48
63 0.49
64 0.56
65 0.53
66 0.52
67 0.53
68 0.44
69 0.42
70 0.37
71 0.35
72 0.27
73 0.22
74 0.18
75 0.12
76 0.11
77 0.08
78 0.08
79 0.08
80 0.08
81 0.09
82 0.09
83 0.1
84 0.1
85 0.11
86 0.14
87 0.14
88 0.13
89 0.11
90 0.11
91 0.12
92 0.12
93 0.13
94 0.1
95 0.09
96 0.09
97 0.1
98 0.11
99 0.11
100 0.11
101 0.11
102 0.13
103 0.14
104 0.13
105 0.15
106 0.18
107 0.18
108 0.2
109 0.25
110 0.24
111 0.25
112 0.3
113 0.32
114 0.31
115 0.33
116 0.38
117 0.34
118 0.41
119 0.45
120 0.5
121 0.57
122 0.6
123 0.62
124 0.62
125 0.66
126 0.64
127 0.67
128 0.67
129 0.64
130 0.62
131 0.61
132 0.53
133 0.5
134 0.43
135 0.35
136 0.26
137 0.17
138 0.12
139 0.09
140 0.07
141 0.05
142 0.05
143 0.05
144 0.04
145 0.04
146 0.05
147 0.06
148 0.06
149 0.07
150 0.07
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.05
157 0.05
158 0.08
159 0.09
160 0.11
161 0.13
162 0.13
163 0.13
164 0.14
165 0.19
166 0.22
167 0.31
168 0.38
169 0.4
170 0.43
171 0.49
172 0.53
173 0.55
174 0.56
175 0.52
176 0.51
177 0.57
178 0.65
179 0.68
180 0.67
181 0.65
182 0.63
183 0.65
184 0.68
185 0.68
186 0.64
187 0.61
188 0.67
189 0.69
190 0.68
191 0.64
192 0.55
193 0.5
194 0.44
195 0.39
196 0.31
197 0.24
198 0.21
199 0.19
200 0.18
201 0.13
202 0.14
203 0.13
204 0.12
205 0.13
206 0.14
207 0.13
208 0.14
209 0.14
210 0.14
211 0.13
212 0.15
213 0.14
214 0.12
215 0.12
216 0.11
217 0.14
218 0.13
219 0.15
220 0.14
221 0.15
222 0.14
223 0.16
224 0.17
225 0.2
226 0.26
227 0.33
228 0.35
229 0.43
230 0.46
231 0.45
232 0.5
233 0.53
234 0.56
235 0.5
236 0.49
237 0.42
238 0.39
239 0.38
240 0.32
241 0.25
242 0.19
243 0.19
244 0.2
245 0.2
246 0.19
247 0.21
248 0.22
249 0.25
250 0.27
251 0.33
252 0.35
253 0.36
254 0.35
255 0.37
256 0.37
257 0.35
258 0.31
259 0.22
260 0.2
261 0.18
262 0.18
263 0.15
264 0.13
265 0.1
266 0.09
267 0.08
268 0.07
269 0.08
270 0.08
271 0.08
272 0.1
273 0.15
274 0.24
275 0.31
276 0.36
277 0.45
278 0.55
279 0.64
280 0.74
281 0.8
282 0.82
283 0.87
284 0.92
285 0.92
286 0.93
287 0.92
288 0.86
289 0.8
290 0.72
291 0.61
292 0.5
293 0.4
294 0.29
295 0.21
296 0.16
297 0.1
298 0.07
299 0.06
300 0.06
301 0.07
302 0.08
303 0.08
304 0.09
305 0.09
306 0.1
307 0.12
308 0.13
309 0.14
310 0.15
311 0.16
312 0.16
313 0.2
314 0.23
315 0.21
316 0.23
317 0.23
318 0.21
319 0.26
320 0.32
321 0.36
322 0.38
323 0.41
324 0.43
325 0.45
326 0.48
327 0.45
328 0.44
329 0.36
330 0.37
331 0.36
332 0.31
333 0.34
334 0.33
335 0.29
336 0.23
337 0.26
338 0.21
339 0.2
340 0.26
341 0.23
342 0.29
343 0.31
344 0.33
345 0.34
346 0.34
347 0.37
348 0.33
349 0.38
350 0.34
351 0.35
352 0.35
353 0.38
354 0.38
355 0.36
356 0.34
357 0.27
358 0.24
359 0.25
360 0.25
361 0.2
362 0.28
363 0.31
364 0.33
365 0.41
366 0.4
367 0.39
368 0.41
369 0.46
370 0.4
371 0.4
372 0.38
373 0.33
374 0.37
375 0.4
376 0.39
377 0.35
378 0.34
379 0.3
380 0.27
381 0.27
382 0.23
383 0.18
384 0.17
385 0.15
386 0.12
387 0.12
388 0.12
389 0.09
390 0.09
391 0.08
392 0.08
393 0.08
394 0.08
395 0.09
396 0.09
397 0.1
398 0.1
399 0.11
400 0.1
401 0.12
402 0.19
403 0.18
404 0.19
405 0.2
406 0.24
407 0.24
408 0.32
409 0.34
410 0.29
411 0.29