Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A423VB10

Protein Details
Accession A0A423VB10    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-77FQAYRDCKKNWVNKRKAEGGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, mito 6, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSAPADKTDDPWNDKTKEKFNTKSRSEWLDPCQEAASRSIKCLNRNGGDRAMCQEYFQAYRDCKKNWVNKRKAEGGGLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.53
4 0.56
5 0.58
6 0.61
7 0.64
8 0.7
9 0.68
10 0.69
11 0.65
12 0.64
13 0.59
14 0.55
15 0.5
16 0.48
17 0.44
18 0.39
19 0.35
20 0.29
21 0.25
22 0.23
23 0.24
24 0.16
25 0.17
26 0.23
27 0.24
28 0.26
29 0.31
30 0.33
31 0.33
32 0.36
33 0.38
34 0.36
35 0.35
36 0.33
37 0.32
38 0.3
39 0.25
40 0.22
41 0.2
42 0.18
43 0.18
44 0.2
45 0.21
46 0.2
47 0.28
48 0.33
49 0.34
50 0.39
51 0.46
52 0.54
53 0.6
54 0.68
55 0.71
56 0.74
57 0.8
58 0.8
59 0.75
60 0.71