Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423W3W8

Protein Details
Accession A0A423W3W8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
168-187EEAARRKRRDDIKRIRYKALBasic
NLS Segment(s)
PositionSequence
171-194ARRKRRDDIKRIRYKALIRRARAR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, pero 1, golg 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MSGKASPADPTKIIKPEDDATKGDDDDTPHEEPIVKFSPEEEAELLQESNTHKAEANALFNSGKYDAAIAKYDEAVSVCPNYLDYELAVLQSNVAACNLKLEEWKDAITTATAAVDKLDKLETRLAEEEKEAAEAKAKDEEEVEDEIVSSGAEKAGPPIPKDEEVDPEEAARRKRRDDIKRIRYKALIRRARARSEAGGWSNLSGAEEDYKTLSKMDNVTPSDRKMIQQQLRTLPAKVKQAQEKETTEMWGKLKDLGNGILKPFGLSTDQFQMVQDPNTGGYSMNFKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.39
4 0.44
5 0.43
6 0.38
7 0.35
8 0.36
9 0.35
10 0.31
11 0.27
12 0.23
13 0.23
14 0.27
15 0.25
16 0.22
17 0.23
18 0.25
19 0.23
20 0.27
21 0.27
22 0.22
23 0.2
24 0.21
25 0.27
26 0.24
27 0.26
28 0.21
29 0.17
30 0.17
31 0.19
32 0.18
33 0.12
34 0.14
35 0.13
36 0.17
37 0.16
38 0.17
39 0.16
40 0.16
41 0.23
42 0.23
43 0.25
44 0.21
45 0.23
46 0.22
47 0.21
48 0.23
49 0.18
50 0.15
51 0.11
52 0.11
53 0.11
54 0.12
55 0.14
56 0.13
57 0.13
58 0.13
59 0.13
60 0.12
61 0.11
62 0.1
63 0.1
64 0.1
65 0.09
66 0.08
67 0.09
68 0.1
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.05
84 0.08
85 0.08
86 0.08
87 0.11
88 0.12
89 0.14
90 0.15
91 0.15
92 0.13
93 0.13
94 0.12
95 0.1
96 0.09
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.1
108 0.13
109 0.13
110 0.15
111 0.17
112 0.17
113 0.16
114 0.16
115 0.15
116 0.12
117 0.13
118 0.1
119 0.08
120 0.11
121 0.11
122 0.11
123 0.14
124 0.14
125 0.13
126 0.13
127 0.14
128 0.12
129 0.13
130 0.12
131 0.08
132 0.08
133 0.08
134 0.07
135 0.06
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.05
142 0.09
143 0.11
144 0.11
145 0.14
146 0.16
147 0.18
148 0.2
149 0.19
150 0.19
151 0.2
152 0.21
153 0.18
154 0.17
155 0.19
156 0.2
157 0.24
158 0.27
159 0.28
160 0.29
161 0.37
162 0.47
163 0.53
164 0.61
165 0.68
166 0.71
167 0.79
168 0.8
169 0.76
170 0.71
171 0.69
172 0.67
173 0.66
174 0.63
175 0.57
176 0.62
177 0.64
178 0.63
179 0.58
180 0.52
181 0.44
182 0.4
183 0.4
184 0.32
185 0.29
186 0.25
187 0.22
188 0.19
189 0.17
190 0.14
191 0.09
192 0.08
193 0.08
194 0.08
195 0.09
196 0.1
197 0.11
198 0.11
199 0.11
200 0.11
201 0.12
202 0.15
203 0.18
204 0.24
205 0.26
206 0.32
207 0.34
208 0.35
209 0.38
210 0.36
211 0.34
212 0.34
213 0.41
214 0.42
215 0.45
216 0.5
217 0.51
218 0.57
219 0.57
220 0.51
221 0.47
222 0.45
223 0.48
224 0.47
225 0.48
226 0.49
227 0.54
228 0.58
229 0.59
230 0.56
231 0.52
232 0.48
233 0.44
234 0.39
235 0.36
236 0.33
237 0.29
238 0.26
239 0.28
240 0.3
241 0.29
242 0.29
243 0.29
244 0.33
245 0.33
246 0.33
247 0.29
248 0.26
249 0.24
250 0.21
251 0.18
252 0.15
253 0.14
254 0.17
255 0.21
256 0.23
257 0.23
258 0.23
259 0.26
260 0.25
261 0.26
262 0.24
263 0.18
264 0.18
265 0.19
266 0.19
267 0.15
268 0.14
269 0.18