Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JX63

Protein Details
Accession G8JX63    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
131-158GISHSGKPLSRKKRKTAVTLAKEPKCKKHydrophilic
NLS Segment(s)
PositionSequence
137-161KPLSRKKRKTAVTLAKEPKCKKTKR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
KEGG erc:Ecym_8149  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MSDYLGNLLNKESVLEWLLSPDHAEYTLQQIDMYKHIRRLSDVVELRNLIRDGRTGRLKCEIGEETLGLSKSSFIYLSKCGDVLPRKLIQEVCQCPACSQAFTTEDVIVLNPKSSEIARLEQRLCNLTKNGISHSGKPLSRKKRKTAVTLAKEPKCKKTKRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.12
5 0.13
6 0.12
7 0.13
8 0.11
9 0.1
10 0.1
11 0.11
12 0.09
13 0.14
14 0.16
15 0.15
16 0.15
17 0.16
18 0.17
19 0.22
20 0.26
21 0.23
22 0.26
23 0.29
24 0.29
25 0.3
26 0.32
27 0.29
28 0.34
29 0.34
30 0.31
31 0.31
32 0.31
33 0.28
34 0.29
35 0.26
36 0.17
37 0.15
38 0.16
39 0.16
40 0.21
41 0.3
42 0.27
43 0.29
44 0.34
45 0.34
46 0.31
47 0.34
48 0.29
49 0.21
50 0.21
51 0.19
52 0.14
53 0.15
54 0.15
55 0.1
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.08
63 0.1
64 0.12
65 0.11
66 0.11
67 0.11
68 0.15
69 0.18
70 0.18
71 0.2
72 0.2
73 0.21
74 0.23
75 0.23
76 0.23
77 0.29
78 0.29
79 0.28
80 0.28
81 0.28
82 0.26
83 0.3
84 0.26
85 0.18
86 0.16
87 0.17
88 0.16
89 0.17
90 0.19
91 0.14
92 0.14
93 0.13
94 0.13
95 0.11
96 0.1
97 0.08
98 0.07
99 0.07
100 0.08
101 0.08
102 0.12
103 0.13
104 0.18
105 0.22
106 0.27
107 0.29
108 0.3
109 0.32
110 0.33
111 0.31
112 0.3
113 0.27
114 0.26
115 0.27
116 0.26
117 0.27
118 0.32
119 0.34
120 0.34
121 0.39
122 0.42
123 0.41
124 0.47
125 0.54
126 0.57
127 0.65
128 0.7
129 0.72
130 0.75
131 0.8
132 0.82
133 0.83
134 0.82
135 0.81
136 0.83
137 0.83
138 0.81
139 0.83
140 0.78
141 0.77
142 0.76