Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423X8M5

Protein Details
Accession A0A423X8M5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKIPWRLSKFQKRRQRHRLRAVDSVVHydrophilic
77-103KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 19.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRVTNPLSSGLLWKIPWRLSKFQKRRQRHRLRAVDSVVETLETALAKKGETVKALERWRAEMPKEDEMLAKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.21
5 0.22
6 0.25
7 0.32
8 0.35
9 0.41
10 0.49
11 0.6
12 0.68
13 0.73
14 0.8
15 0.83
16 0.88
17 0.91
18 0.92
19 0.91
20 0.92
21 0.92
22 0.87
23 0.83
24 0.74
25 0.66
26 0.55
27 0.45
28 0.34
29 0.24
30 0.18
31 0.11
32 0.09
33 0.06
34 0.05
35 0.05
36 0.06
37 0.05
38 0.07
39 0.1
40 0.1
41 0.11
42 0.13
43 0.15
44 0.22
45 0.24
46 0.26
47 0.24
48 0.26
49 0.28
50 0.29
51 0.27
52 0.28
53 0.31
54 0.31
55 0.31
56 0.29
57 0.27
58 0.26
59 0.28
60 0.21
61 0.17
62 0.14
63 0.14
64 0.16
65 0.2
66 0.24
67 0.24
68 0.33
69 0.4
70 0.49
71 0.58
72 0.64
73 0.67
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79