Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JVH3

Protein Details
Accession G8JVH3    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVQKALKVTKKPKDPRRITKKQMNLKKAAHydrophilic
NLS Segment(s)
PositionSequence
7-44KVTKKPKDPRRITKKQMNLKKAAPLQLKSRKKSLQHMK
81-88KKSKLAKK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG erc:Ecym_6271  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQKALKVTKKPKDPRRITKKQMNLKKAAPLQLKSRKKSLQHMKKLAKTCSRTEATERFVASRVGHLELLKGTRRQLEEQKKSKLAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.91
5 0.9
6 0.89
7 0.89
8 0.88
9 0.87
10 0.83
11 0.78
12 0.7
13 0.69
14 0.63
15 0.61
16 0.55
17 0.48
18 0.51
19 0.55
20 0.6
21 0.55
22 0.58
23 0.56
24 0.55
25 0.62
26 0.64
27 0.64
28 0.66
29 0.72
30 0.72
31 0.73
32 0.75
33 0.71
34 0.67
35 0.6
36 0.53
37 0.51
38 0.46
39 0.42
40 0.42
41 0.41
42 0.37
43 0.36
44 0.34
45 0.28
46 0.26
47 0.26
48 0.21
49 0.19
50 0.18
51 0.17
52 0.17
53 0.16
54 0.16
55 0.17
56 0.2
57 0.21
58 0.21
59 0.21
60 0.26
61 0.29
62 0.34
63 0.43
64 0.5
65 0.57
66 0.64
67 0.7
68 0.72