Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423VIS3

Protein Details
Accession A0A423VIS3   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
139-166LRDRRIGDRRARSAEKKRKKGRGSCIILBasic
NLS Segment(s)
PositionSequence
25-37KFRKSQAKDKGKG
127-160RRDKAGERGRKSLRDRRIGDRRARSAEKKRKKGR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MEVAGSAVYIASFKQQNIRKAMSSKFRKSQAKDKGKGKDTAPGPSTYKAEPSTSMSKGHSHAAVLSGDSSKAHTHRSVDRGRERTKHGEESPPQIPGQESGSSRAWYTDSASYSPYTGPAEYNVNNRRDKAGERGRKSLRDRRIGDRRARSAEKKRKKGRGSCIIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.35
4 0.41
5 0.45
6 0.45
7 0.48
8 0.54
9 0.56
10 0.59
11 0.61
12 0.62
13 0.67
14 0.71
15 0.72
16 0.75
17 0.76
18 0.77
19 0.77
20 0.78
21 0.78
22 0.75
23 0.74
24 0.64
25 0.61
26 0.53
27 0.52
28 0.46
29 0.4
30 0.38
31 0.36
32 0.37
33 0.29
34 0.31
35 0.25
36 0.24
37 0.22
38 0.24
39 0.26
40 0.25
41 0.27
42 0.25
43 0.25
44 0.26
45 0.26
46 0.21
47 0.16
48 0.15
49 0.14
50 0.13
51 0.11
52 0.1
53 0.08
54 0.08
55 0.07
56 0.09
57 0.08
58 0.09
59 0.12
60 0.12
61 0.15
62 0.19
63 0.26
64 0.3
65 0.36
66 0.42
67 0.47
68 0.49
69 0.5
70 0.51
71 0.51
72 0.5
73 0.49
74 0.43
75 0.44
76 0.42
77 0.44
78 0.4
79 0.34
80 0.3
81 0.25
82 0.23
83 0.16
84 0.17
85 0.15
86 0.14
87 0.16
88 0.18
89 0.18
90 0.18
91 0.18
92 0.15
93 0.13
94 0.15
95 0.15
96 0.15
97 0.15
98 0.16
99 0.16
100 0.16
101 0.16
102 0.15
103 0.12
104 0.11
105 0.11
106 0.11
107 0.16
108 0.17
109 0.26
110 0.31
111 0.35
112 0.37
113 0.38
114 0.39
115 0.37
116 0.38
117 0.39
118 0.43
119 0.48
120 0.51
121 0.59
122 0.62
123 0.68
124 0.73
125 0.72
126 0.71
127 0.71
128 0.71
129 0.72
130 0.76
131 0.77
132 0.78
133 0.78
134 0.77
135 0.75
136 0.78
137 0.78
138 0.78
139 0.81
140 0.82
141 0.83
142 0.86
143 0.88
144 0.91
145 0.91
146 0.9