Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WUH7

Protein Details
Accession A0A423WUH7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
119-140GGKGAKPVKKVAKRTKVAKEEDBasic
NLS Segment(s)
PositionSequence
83-97PKKAAAGGGKKRGRK
120-134GKGAKPVKKVAKRTK
Subcellular Location(s) cyto 23, mito 3
Family & Domain DBs
Amino Acid Sequences MPPKAQPNPAPCGLTPRETEIAVLAWKAIEADGKINNTTLAALANIGKPESAGRMWRSIKAKIETGTAAPAGASTQATAAPVPKKAAAGGGKKRGRKEVSSDESVDNDANGSEDVKGQGGKGAKPVKKVAKRTKVAKEEDPANSEGVDDDSDVGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.36
4 0.34
5 0.31
6 0.31
7 0.24
8 0.22
9 0.18
10 0.16
11 0.1
12 0.08
13 0.08
14 0.08
15 0.07
16 0.07
17 0.07
18 0.1
19 0.13
20 0.15
21 0.15
22 0.16
23 0.15
24 0.14
25 0.13
26 0.1
27 0.07
28 0.06
29 0.06
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.1
38 0.1
39 0.12
40 0.14
41 0.21
42 0.23
43 0.28
44 0.31
45 0.33
46 0.37
47 0.36
48 0.37
49 0.31
50 0.32
51 0.27
52 0.24
53 0.21
54 0.15
55 0.12
56 0.09
57 0.07
58 0.06
59 0.05
60 0.05
61 0.03
62 0.04
63 0.04
64 0.04
65 0.05
66 0.07
67 0.08
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.14
74 0.17
75 0.23
76 0.29
77 0.38
78 0.42
79 0.46
80 0.48
81 0.51
82 0.5
83 0.45
84 0.46
85 0.46
86 0.48
87 0.48
88 0.48
89 0.41
90 0.38
91 0.37
92 0.29
93 0.19
94 0.13
95 0.09
96 0.07
97 0.07
98 0.06
99 0.05
100 0.06
101 0.07
102 0.08
103 0.08
104 0.07
105 0.11
106 0.12
107 0.13
108 0.2
109 0.28
110 0.3
111 0.34
112 0.42
113 0.49
114 0.55
115 0.65
116 0.69
117 0.7
118 0.76
119 0.81
120 0.83
121 0.82
122 0.8
123 0.76
124 0.71
125 0.68
126 0.64
127 0.59
128 0.5
129 0.42
130 0.36
131 0.29
132 0.23
133 0.18
134 0.14
135 0.1
136 0.09