Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A423WUF7

Protein Details
Accession A0A423WUF7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAKPKKSRNNKRTKRPKGSNKDWKENMSHydrophilic
NLS Segment(s)
PositionSequence
3-21KPKKSRNNKRTKRPKGSNK
Subcellular Location(s) nucl 16.5, mito_nucl 12.833, mito 8, cyto_mito 4.833
Family & Domain DBs
Amino Acid Sequences MAKPKKSRNNKRTKRPKGSNKDWKENMSGSGWKLLELIPMVDSVIIDRRPDIVGHLTAYSIAAAAVAEISWLGDQAELMTGSLKGIEENISSMNFGGDNFPGRVHGYVRSMIDKYLSSDTQHYFAVFNLSDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.95
4 0.94
5 0.95
6 0.95
7 0.93
8 0.92
9 0.85
10 0.78
11 0.72
12 0.62
13 0.54
14 0.46
15 0.4
16 0.3
17 0.31
18 0.27
19 0.22
20 0.21
21 0.19
22 0.16
23 0.14
24 0.13
25 0.08
26 0.08
27 0.08
28 0.07
29 0.07
30 0.06
31 0.09
32 0.09
33 0.09
34 0.09
35 0.11
36 0.11
37 0.11
38 0.13
39 0.11
40 0.11
41 0.12
42 0.12
43 0.11
44 0.1
45 0.1
46 0.08
47 0.05
48 0.04
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.04
72 0.04
73 0.05
74 0.05
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.07
84 0.07
85 0.09
86 0.1
87 0.1
88 0.11
89 0.12
90 0.14
91 0.14
92 0.16
93 0.16
94 0.19
95 0.21
96 0.24
97 0.23
98 0.22
99 0.23
100 0.2
101 0.21
102 0.23
103 0.23
104 0.21
105 0.25
106 0.27
107 0.27
108 0.27
109 0.24
110 0.19
111 0.19
112 0.22