Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R748

Protein Details
Accession C4R748   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-76DDHKAFLAKHKVHRHKLKEMEKDEBasic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 11.5, nucl 6, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009078  Ferritin-like_SF  
IPR012348  RNR-like  
IPR033909  RNR_small  
IPR030475  RNR_small_AS  
IPR000358  RNR_small_fam  
Gene Ontology GO:0005634  C:nucleus  
GO:0005971  C:ribonucleoside-diphosphate reductase complex  
GO:0008198  F:ferrous iron binding  
GO:0046982  F:protein heterodimerization activity  
GO:0004748  F:ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor  
GO:0008270  F:zinc ion binding  
GO:0009263  P:deoxyribonucleotide biosynthetic process  
KEGG ppa:PAS_chr4_0197  -  
Pfam View protein in Pfam  
PF00268  Ribonuc_red_sm  
PROSITE View protein in PROSITE  
PS00368  RIBORED_SMALL  
CDD cd01049  RNRR2  
Amino Acid Sequences MSVQETPTKGAKAALSNLDINLSKKDLTSVLQAAADQKEKVNAPVKEESKLDDDHKAFLAKHKVHRHKLKEMEKDEPLLVENKRRFVLFPLKYHDIWQMYKQAEASFWTAEEIDLGKDLHDWNNRMNDNEKFFISRVLAFFAASDGIVNENLVENFSAEVQLPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESEFLFNAIETIPCIKEKADWAMRWISDDDALFAERLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLNNRASEEIVEKIITEAVEIEKRYFTDALPVSLLGMNCSLMCQYVEFVADRLLVALGNKKVYNVNNPFDFMENISLAGKTNFFEKRVSDYQKAGVMASTDKTSNDDAFAFDEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.32
5 0.33
6 0.31
7 0.28
8 0.25
9 0.23
10 0.2
11 0.19
12 0.21
13 0.19
14 0.19
15 0.23
16 0.23
17 0.22
18 0.22
19 0.22
20 0.24
21 0.26
22 0.26
23 0.21
24 0.2
25 0.23
26 0.24
27 0.3
28 0.35
29 0.32
30 0.36
31 0.44
32 0.45
33 0.44
34 0.44
35 0.4
36 0.36
37 0.38
38 0.34
39 0.34
40 0.33
41 0.32
42 0.33
43 0.32
44 0.29
45 0.33
46 0.4
47 0.38
48 0.46
49 0.55
50 0.63
51 0.7
52 0.8
53 0.8
54 0.8
55 0.84
56 0.84
57 0.84
58 0.78
59 0.75
60 0.67
61 0.62
62 0.53
63 0.43
64 0.35
65 0.3
66 0.28
67 0.3
68 0.3
69 0.31
70 0.32
71 0.31
72 0.31
73 0.32
74 0.4
75 0.37
76 0.4
77 0.44
78 0.47
79 0.47
80 0.49
81 0.48
82 0.41
83 0.38
84 0.36
85 0.35
86 0.31
87 0.32
88 0.3
89 0.25
90 0.21
91 0.22
92 0.2
93 0.14
94 0.13
95 0.13
96 0.12
97 0.11
98 0.11
99 0.09
100 0.07
101 0.08
102 0.08
103 0.07
104 0.08
105 0.1
106 0.15
107 0.19
108 0.2
109 0.23
110 0.3
111 0.31
112 0.32
113 0.35
114 0.33
115 0.33
116 0.34
117 0.3
118 0.25
119 0.24
120 0.25
121 0.22
122 0.19
123 0.15
124 0.16
125 0.15
126 0.13
127 0.13
128 0.11
129 0.09
130 0.07
131 0.07
132 0.04
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.06
145 0.05
146 0.05
147 0.06
148 0.09
149 0.09
150 0.09
151 0.1
152 0.09
153 0.09
154 0.1
155 0.1
156 0.11
157 0.11
158 0.11
159 0.14
160 0.14
161 0.14
162 0.14
163 0.14
164 0.09
165 0.1
166 0.09
167 0.05
168 0.05
169 0.06
170 0.05
171 0.04
172 0.04
173 0.04
174 0.05
175 0.06
176 0.09
177 0.11
178 0.11
179 0.11
180 0.12
181 0.13
182 0.18
183 0.17
184 0.17
185 0.15
186 0.15
187 0.15
188 0.15
189 0.14
190 0.09
191 0.08
192 0.06
193 0.07
194 0.06
195 0.06
196 0.07
197 0.07
198 0.08
199 0.1
200 0.17
201 0.2
202 0.2
203 0.23
204 0.25
205 0.25
206 0.25
207 0.24
208 0.18
209 0.14
210 0.13
211 0.12
212 0.09
213 0.1
214 0.08
215 0.07
216 0.07
217 0.06
218 0.06
219 0.05
220 0.04
221 0.04
222 0.04
223 0.05
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.03
232 0.04
233 0.04
234 0.04
235 0.05
236 0.09
237 0.1
238 0.11
239 0.15
240 0.15
241 0.2
242 0.21
243 0.24
244 0.23
245 0.25
246 0.26
247 0.27
248 0.28
249 0.25
250 0.24
251 0.2
252 0.21
253 0.19
254 0.18
255 0.15
256 0.14
257 0.13
258 0.14
259 0.15
260 0.13
261 0.15
262 0.16
263 0.14
264 0.15
265 0.14
266 0.14
267 0.13
268 0.11
269 0.1
270 0.1
271 0.1
272 0.15
273 0.21
274 0.24
275 0.23
276 0.26
277 0.25
278 0.24
279 0.24
280 0.21
281 0.16
282 0.14
283 0.14
284 0.11
285 0.11
286 0.11
287 0.1
288 0.08
289 0.07
290 0.09
291 0.12
292 0.13
293 0.14
294 0.14
295 0.15
296 0.17
297 0.17
298 0.14
299 0.2
300 0.2
301 0.21
302 0.2
303 0.2
304 0.18
305 0.2
306 0.2
307 0.12
308 0.11
309 0.1
310 0.09
311 0.1
312 0.08
313 0.07
314 0.07
315 0.07
316 0.07
317 0.08
318 0.1
319 0.09
320 0.1
321 0.1
322 0.1
323 0.1
324 0.09
325 0.09
326 0.08
327 0.08
328 0.14
329 0.15
330 0.18
331 0.18
332 0.19
333 0.25
334 0.28
335 0.37
336 0.38
337 0.42
338 0.41
339 0.43
340 0.43
341 0.4
342 0.37
343 0.29
344 0.25
345 0.19
346 0.18
347 0.16
348 0.15
349 0.14
350 0.14
351 0.13
352 0.1
353 0.17
354 0.19
355 0.2
356 0.23
357 0.24
358 0.31
359 0.4
360 0.47
361 0.45
362 0.45
363 0.47
364 0.49
365 0.47
366 0.39
367 0.31
368 0.25
369 0.23
370 0.22
371 0.21
372 0.17
373 0.17
374 0.2
375 0.22
376 0.21
377 0.21
378 0.19
379 0.18
380 0.2