Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8JSA8

Protein Details
Accession G8JSA8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-44ILSARHRKEKKDLQNQITGLKKQSTKRTRKQVNARCEELTHydrophilic
105-130EVESRPGKRMNRRKQRLAKAQRDADRBasic
NLS Segment(s)
PositionSequence
110-123PGKRMNRRKQRLAK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
KEGG erc:Ecym_4598  -  
Pfam View protein in Pfam  
PF02338  OTU  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22762  OTU_fungi_OTU2-like  
Amino Acid Sequences MEEEILSARHRKEKKDLQNQITGLKKQSTKRTRKQVNARCEELTSELEKRHVEELRQFRIAQGIEIAGDGDEQEEEVTPEKLLEQMSLEKNGNDEESVPKPLETEVESRPGKRMNRRKQRLAKAQRDADRIREEALAEAAMQPDLKGMEEEVLEKVCELNGLTQVEIQPDGNCLFAAILDQLRIRHNNIDGGVSYYYPESYEGPKCIDSLGISDLRSLSCCYVREHRDDFIPYLFEDNDTTTDIEVYTEKMETTATWGGEIELLALSHVFRCCISVMISGGSTLKINEHEMANAELKIIYYKHKYALGEHYNSLHDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.79
4 0.77
5 0.8
6 0.76
7 0.73
8 0.7
9 0.62
10 0.55
11 0.52
12 0.52
13 0.5
14 0.6
15 0.63
16 0.66
17 0.73
18 0.8
19 0.83
20 0.87
21 0.91
22 0.9
23 0.9
24 0.87
25 0.81
26 0.72
27 0.62
28 0.54
29 0.46
30 0.4
31 0.33
32 0.28
33 0.25
34 0.26
35 0.26
36 0.26
37 0.29
38 0.28
39 0.28
40 0.34
41 0.41
42 0.44
43 0.46
44 0.44
45 0.38
46 0.41
47 0.38
48 0.29
49 0.22
50 0.16
51 0.13
52 0.13
53 0.12
54 0.06
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.09
69 0.09
70 0.09
71 0.09
72 0.15
73 0.17
74 0.21
75 0.21
76 0.19
77 0.2
78 0.2
79 0.19
80 0.13
81 0.12
82 0.13
83 0.14
84 0.17
85 0.16
86 0.15
87 0.15
88 0.15
89 0.15
90 0.14
91 0.15
92 0.15
93 0.23
94 0.24
95 0.24
96 0.27
97 0.31
98 0.35
99 0.41
100 0.51
101 0.54
102 0.64
103 0.72
104 0.8
105 0.84
106 0.88
107 0.88
108 0.88
109 0.87
110 0.84
111 0.83
112 0.78
113 0.75
114 0.66
115 0.6
116 0.53
117 0.43
118 0.36
119 0.3
120 0.24
121 0.18
122 0.17
123 0.11
124 0.08
125 0.08
126 0.06
127 0.06
128 0.05
129 0.04
130 0.05
131 0.05
132 0.05
133 0.04
134 0.04
135 0.05
136 0.05
137 0.06
138 0.06
139 0.07
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.04
146 0.05
147 0.07
148 0.08
149 0.08
150 0.09
151 0.09
152 0.09
153 0.1
154 0.09
155 0.06
156 0.07
157 0.08
158 0.07
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.06
168 0.08
169 0.1
170 0.12
171 0.13
172 0.15
173 0.15
174 0.17
175 0.17
176 0.17
177 0.15
178 0.16
179 0.14
180 0.12
181 0.11
182 0.09
183 0.09
184 0.08
185 0.09
186 0.08
187 0.11
188 0.14
189 0.15
190 0.17
191 0.17
192 0.17
193 0.16
194 0.15
195 0.11
196 0.11
197 0.12
198 0.12
199 0.12
200 0.12
201 0.13
202 0.12
203 0.13
204 0.12
205 0.11
206 0.13
207 0.14
208 0.17
209 0.25
210 0.29
211 0.34
212 0.36
213 0.36
214 0.37
215 0.38
216 0.36
217 0.29
218 0.26
219 0.2
220 0.2
221 0.18
222 0.15
223 0.13
224 0.13
225 0.13
226 0.13
227 0.13
228 0.11
229 0.11
230 0.1
231 0.1
232 0.09
233 0.09
234 0.08
235 0.08
236 0.08
237 0.08
238 0.08
239 0.07
240 0.12
241 0.14
242 0.13
243 0.13
244 0.14
245 0.14
246 0.14
247 0.14
248 0.09
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.08
255 0.09
256 0.09
257 0.08
258 0.1
259 0.1
260 0.12
261 0.14
262 0.13
263 0.14
264 0.15
265 0.15
266 0.14
267 0.14
268 0.13
269 0.12
270 0.1
271 0.11
272 0.11
273 0.14
274 0.16
275 0.16
276 0.17
277 0.18
278 0.21
279 0.22
280 0.19
281 0.17
282 0.15
283 0.15
284 0.16
285 0.16
286 0.19
287 0.23
288 0.26
289 0.29
290 0.34
291 0.35
292 0.37
293 0.46
294 0.48
295 0.46
296 0.45
297 0.44