Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I6NE32

Protein Details
Accession I6NE32    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
135-163LVSVNKKSTGRHRAKKRKKNSLINVLAVKHydrophilic
NLS Segment(s)
PositionSequence
140-153KKSTGRHRAKKRKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG erc:Ecym_5586  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MNKLDKERFRDIHIRHKYNILHKVLNVGTPQLSGLYLKSFYNAVKRNRLVLPNSIIEGDRKFCGSCGVIYVSGYTLASKVQNIESADSIERILVYDCLQCGHKKEFPLSIEVKTSKEVEMVEFSNFRSKETTSNLVSVNKKSTGRHRAKKRKKNSLINVLAVKKQQTDSKNKITLSLSDFLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.63
4 0.62
5 0.62
6 0.66
7 0.61
8 0.53
9 0.48
10 0.52
11 0.46
12 0.42
13 0.34
14 0.27
15 0.22
16 0.19
17 0.19
18 0.12
19 0.12
20 0.09
21 0.09
22 0.1
23 0.11
24 0.1
25 0.11
26 0.12
27 0.13
28 0.22
29 0.28
30 0.32
31 0.4
32 0.41
33 0.45
34 0.48
35 0.51
36 0.45
37 0.43
38 0.42
39 0.34
40 0.33
41 0.29
42 0.25
43 0.22
44 0.2
45 0.17
46 0.13
47 0.13
48 0.12
49 0.11
50 0.14
51 0.13
52 0.11
53 0.12
54 0.13
55 0.12
56 0.12
57 0.12
58 0.1
59 0.09
60 0.09
61 0.07
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.1
69 0.11
70 0.12
71 0.11
72 0.12
73 0.12
74 0.11
75 0.11
76 0.08
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.06
83 0.06
84 0.07
85 0.08
86 0.09
87 0.12
88 0.16
89 0.18
90 0.19
91 0.21
92 0.24
93 0.24
94 0.28
95 0.27
96 0.24
97 0.26
98 0.25
99 0.24
100 0.22
101 0.22
102 0.17
103 0.16
104 0.15
105 0.12
106 0.14
107 0.14
108 0.14
109 0.13
110 0.14
111 0.19
112 0.19
113 0.19
114 0.18
115 0.18
116 0.22
117 0.27
118 0.31
119 0.26
120 0.29
121 0.3
122 0.34
123 0.36
124 0.34
125 0.32
126 0.32
127 0.32
128 0.34
129 0.41
130 0.46
131 0.54
132 0.61
133 0.69
134 0.76
135 0.84
136 0.91
137 0.92
138 0.93
139 0.93
140 0.94
141 0.92
142 0.92
143 0.86
144 0.82
145 0.78
146 0.7
147 0.63
148 0.54
149 0.46
150 0.38
151 0.36
152 0.37
153 0.37
154 0.44
155 0.49
156 0.56
157 0.6
158 0.57
159 0.59
160 0.54
161 0.52
162 0.47
163 0.42