Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A425BPH9

Protein Details
Accession A0A425BPH9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
126-146SRDGAERSRKGKPKNSKRKVNBasic
NLS Segment(s)
PositionSequence
131-146ERSRKGKPKNSKRKVN
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Amino Acid Sequences MTYLRLNGVKAREHPVFKELTRVKEYFAKISVAENPSVQQPNLKLDKQAANRFITSGLAGNDKVELQKAEQQAKERARSYIKTQDSSKKRKVGEIAGGDESHSSSASEPLSNLRSSNSEDNIDQASRDGAERSRKGKPKNSKRKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.41
4 0.35
5 0.42
6 0.4
7 0.41
8 0.44
9 0.42
10 0.41
11 0.43
12 0.45
13 0.39
14 0.36
15 0.31
16 0.25
17 0.27
18 0.31
19 0.25
20 0.24
21 0.21
22 0.2
23 0.23
24 0.24
25 0.22
26 0.19
27 0.18
28 0.25
29 0.29
30 0.29
31 0.25
32 0.28
33 0.36
34 0.4
35 0.44
36 0.41
37 0.38
38 0.38
39 0.37
40 0.33
41 0.25
42 0.19
43 0.14
44 0.11
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.07
53 0.07
54 0.12
55 0.16
56 0.2
57 0.21
58 0.24
59 0.31
60 0.34
61 0.37
62 0.33
63 0.32
64 0.31
65 0.32
66 0.34
67 0.36
68 0.36
69 0.35
70 0.38
71 0.44
72 0.5
73 0.56
74 0.58
75 0.55
76 0.53
77 0.54
78 0.53
79 0.49
80 0.48
81 0.42
82 0.39
83 0.34
84 0.33
85 0.29
86 0.25
87 0.2
88 0.13
89 0.1
90 0.07
91 0.06
92 0.08
93 0.09
94 0.09
95 0.1
96 0.13
97 0.16
98 0.16
99 0.15
100 0.15
101 0.16
102 0.21
103 0.25
104 0.24
105 0.25
106 0.24
107 0.26
108 0.28
109 0.25
110 0.21
111 0.16
112 0.14
113 0.12
114 0.13
115 0.13
116 0.16
117 0.25
118 0.3
119 0.35
120 0.44
121 0.51
122 0.59
123 0.67
124 0.73
125 0.75
126 0.81