Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JTT9

Protein Details
Accession G8JTT9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
7-26HTAHNQTKKAHRNGIKKPRTBasic
NLS Segment(s)
PositionSequence
14-63KKAHRNGIKKPRTHKYPSLKGVDAKFRRNHKYALHGTAKALAAKRAAEKK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG erc:Ecym_4387  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTKKAHRNGIKKPRTHKYPSLKGVDAKFRRNHKYALHGTAKALAAKRAAEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.75
4 0.73
5 0.72
6 0.75
7 0.8
8 0.79
9 0.76
10 0.77
11 0.77
12 0.76
13 0.73
14 0.71
15 0.7
16 0.72
17 0.72
18 0.68
19 0.61
20 0.57
21 0.53
22 0.54
23 0.48
24 0.46
25 0.46
26 0.49
27 0.53
28 0.52
29 0.54
30 0.48
31 0.53
32 0.52
33 0.55
34 0.53
35 0.47
36 0.45
37 0.45
38 0.42
39 0.37
40 0.32
41 0.26
42 0.23
43 0.24