Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A425BPJ4

Protein Details
Accession A0A425BPJ4    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-51LVNRGWIPKKFKKQADRPDSTPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, cyto_mito 6, mito 5.5, cyto 5.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002994  Surf1/Shy1  
IPR045214  Surf1/Surf4  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF02104  SURF1  
PROSITE View protein in PROSITE  
PS50895  SURF1  
CDD cd06662  SURF1  
Amino Acid Sequences MLIGPRVRDGNDGYLVVTPLEREGDGTTVLVNRGWIPKKFKKQADRPDSTPQGELTVEGLLREPLKKNWFTPENKPETKEFYFPDVFQMARLTNSQPVWIEETMVLRPACFAYASKSSLTCSKNQSEACTMAANVSLLILALLFPPTRANVVANLFTTPAGSDGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.18
4 0.15
5 0.11
6 0.09
7 0.1
8 0.09
9 0.09
10 0.1
11 0.1
12 0.11
13 0.1
14 0.1
15 0.1
16 0.11
17 0.1
18 0.09
19 0.1
20 0.17
21 0.22
22 0.26
23 0.34
24 0.43
25 0.53
26 0.62
27 0.68
28 0.71
29 0.77
30 0.83
31 0.84
32 0.81
33 0.76
34 0.76
35 0.73
36 0.64
37 0.55
38 0.44
39 0.36
40 0.29
41 0.24
42 0.15
43 0.11
44 0.09
45 0.08
46 0.08
47 0.07
48 0.08
49 0.1
50 0.11
51 0.14
52 0.2
53 0.21
54 0.22
55 0.29
56 0.35
57 0.38
58 0.45
59 0.49
60 0.52
61 0.52
62 0.53
63 0.47
64 0.47
65 0.44
66 0.38
67 0.3
68 0.27
69 0.26
70 0.24
71 0.25
72 0.2
73 0.17
74 0.15
75 0.15
76 0.1
77 0.1
78 0.11
79 0.1
80 0.12
81 0.13
82 0.13
83 0.12
84 0.13
85 0.16
86 0.15
87 0.14
88 0.12
89 0.13
90 0.12
91 0.15
92 0.14
93 0.1
94 0.11
95 0.1
96 0.1
97 0.09
98 0.09
99 0.1
100 0.14
101 0.16
102 0.17
103 0.17
104 0.18
105 0.24
106 0.26
107 0.26
108 0.28
109 0.3
110 0.35
111 0.36
112 0.38
113 0.35
114 0.34
115 0.32
116 0.27
117 0.24
118 0.18
119 0.17
120 0.14
121 0.09
122 0.08
123 0.06
124 0.05
125 0.04
126 0.04
127 0.03
128 0.03
129 0.05
130 0.05
131 0.06
132 0.07
133 0.08
134 0.1
135 0.11
136 0.12
137 0.15
138 0.19
139 0.22
140 0.21
141 0.21
142 0.2
143 0.19
144 0.18
145 0.14