Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A425BM34

Protein Details
Accession A0A425BM34    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
158-179TPQIKRGPGRPPKNPQPQRSSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001487  Bromodomain  
IPR036427  Bromodomain-like_sf  
IPR037382  Rsc/polybromo  
Gene Ontology GO:0016586  C:RSC-type complex  
GO:0006338  P:chromatin remodeling  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00439  Bromodomain  
PROSITE View protein in PROSITE  
PS50014  BROMODOMAIN_2  
CDD cd04369  Bromodomain  
Amino Acid Sequences DFGDETPETTTEKGLAFVEHLKKTTDKSGRLVATNFLTLPNKRQLPDYYKIIKLPVALDTIQAKLMRREFPTLSTLESYFKRMIANAKEYNQKGSEIYDDAERIRKALSNYMTKNNPAYKTPGYVAVPTPVPAELLAENSDSEADAEGEMEEEAIEATPQIKRGPGRPPKNPQPQRSSATPATSENYDDVSFDGLTFQQAQEKIVSDMIRYKEDPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.21
5 0.27
6 0.28
7 0.28
8 0.29
9 0.3
10 0.33
11 0.41
12 0.41
13 0.38
14 0.4
15 0.46
16 0.47
17 0.48
18 0.46
19 0.4
20 0.34
21 0.32
22 0.28
23 0.23
24 0.25
25 0.22
26 0.26
27 0.31
28 0.32
29 0.31
30 0.36
31 0.39
32 0.41
33 0.46
34 0.49
35 0.46
36 0.45
37 0.46
38 0.43
39 0.37
40 0.31
41 0.26
42 0.2
43 0.18
44 0.15
45 0.16
46 0.16
47 0.15
48 0.17
49 0.17
50 0.16
51 0.18
52 0.22
53 0.24
54 0.25
55 0.29
56 0.27
57 0.28
58 0.3
59 0.26
60 0.24
61 0.21
62 0.2
63 0.18
64 0.18
65 0.2
66 0.17
67 0.17
68 0.16
69 0.15
70 0.21
71 0.21
72 0.27
73 0.27
74 0.3
75 0.36
76 0.36
77 0.38
78 0.33
79 0.29
80 0.23
81 0.21
82 0.19
83 0.13
84 0.13
85 0.11
86 0.11
87 0.11
88 0.14
89 0.13
90 0.12
91 0.11
92 0.13
93 0.13
94 0.18
95 0.21
96 0.24
97 0.27
98 0.32
99 0.33
100 0.31
101 0.34
102 0.33
103 0.31
104 0.25
105 0.28
106 0.24
107 0.25
108 0.24
109 0.25
110 0.21
111 0.21
112 0.2
113 0.17
114 0.16
115 0.14
116 0.14
117 0.1
118 0.09
119 0.08
120 0.08
121 0.07
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.06
129 0.06
130 0.05
131 0.05
132 0.04
133 0.05
134 0.04
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.04
141 0.03
142 0.03
143 0.03
144 0.04
145 0.05
146 0.07
147 0.08
148 0.11
149 0.13
150 0.18
151 0.29
152 0.38
153 0.46
154 0.54
155 0.63
156 0.7
157 0.8
158 0.84
159 0.82
160 0.81
161 0.79
162 0.75
163 0.7
164 0.67
165 0.6
166 0.54
167 0.48
168 0.42
169 0.38
170 0.34
171 0.31
172 0.24
173 0.23
174 0.19
175 0.17
176 0.15
177 0.14
178 0.13
179 0.11
180 0.11
181 0.09
182 0.11
183 0.12
184 0.11
185 0.15
186 0.16
187 0.17
188 0.18
189 0.19
190 0.19
191 0.22
192 0.22
193 0.18
194 0.24
195 0.26
196 0.3