Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A425BK05

Protein Details
Accession A0A425BK05    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
336-362IRGLRRLVDEHRKRRREKPVSVTREGIBasic
NLS Segment(s)
PositionSequence
346-354HRKRRREKP
Subcellular Location(s) mito 21, cyto_mito 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007849  ATP10  
Pfam View protein in Pfam  
PF05176  ATP-synt_10  
Amino Acid Sequences RGWQNFAADTQRPNFRKVARSRVIMFLSRRLRWSAGVRLDSGTCLSCQWRSFSASYHHLKDAEPSPPAPEAAPAASPAQPERPSALEGAPRASGKIVNEFTPKPLDRPIGLTKPPRAGENTGIDHRTWKQRRDDFVDYDKHLAKRKQLTAKMSTPYYREWTNMRHHKGKSFIAPPKLFKADRALFFPNFYGQTLLKDKISRDTTPVLEDKVSVVTIFNSAWAENQAATFTSKKQNPELHQILEYNKDIAQRVQINIEDNFMKAWIIKLFRPRMRSLLSKEDWGRYFVVTKGVTEENKDAIGLLNSKVGYTYLLDADCRIRWAASGIAQPDEKEGLIRGLRRLVDEHRKRRREKPVSVTREGIPDAAKRVNEAKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.55
4 0.58
5 0.64
6 0.61
7 0.65
8 0.65
9 0.66
10 0.64
11 0.61
12 0.56
13 0.54
14 0.55
15 0.51
16 0.5
17 0.46
18 0.44
19 0.43
20 0.46
21 0.45
22 0.45
23 0.45
24 0.43
25 0.42
26 0.4
27 0.36
28 0.31
29 0.23
30 0.16
31 0.15
32 0.16
33 0.18
34 0.19
35 0.22
36 0.23
37 0.27
38 0.27
39 0.3
40 0.34
41 0.38
42 0.43
43 0.43
44 0.43
45 0.39
46 0.39
47 0.4
48 0.38
49 0.34
50 0.3
51 0.27
52 0.27
53 0.27
54 0.27
55 0.21
56 0.18
57 0.15
58 0.14
59 0.14
60 0.13
61 0.14
62 0.14
63 0.15
64 0.16
65 0.2
66 0.2
67 0.21
68 0.22
69 0.22
70 0.22
71 0.23
72 0.23
73 0.21
74 0.21
75 0.21
76 0.21
77 0.19
78 0.18
79 0.18
80 0.17
81 0.14
82 0.21
83 0.2
84 0.21
85 0.26
86 0.26
87 0.28
88 0.33
89 0.32
90 0.27
91 0.3
92 0.3
93 0.26
94 0.31
95 0.36
96 0.35
97 0.4
98 0.43
99 0.42
100 0.46
101 0.46
102 0.42
103 0.39
104 0.36
105 0.35
106 0.36
107 0.36
108 0.33
109 0.33
110 0.31
111 0.31
112 0.31
113 0.37
114 0.37
115 0.39
116 0.45
117 0.5
118 0.56
119 0.61
120 0.63
121 0.58
122 0.59
123 0.58
124 0.5
125 0.47
126 0.45
127 0.4
128 0.41
129 0.38
130 0.39
131 0.42
132 0.48
133 0.52
134 0.54
135 0.56
136 0.56
137 0.58
138 0.55
139 0.49
140 0.44
141 0.37
142 0.34
143 0.32
144 0.26
145 0.23
146 0.23
147 0.26
148 0.34
149 0.41
150 0.44
151 0.48
152 0.48
153 0.5
154 0.52
155 0.5
156 0.46
157 0.45
158 0.45
159 0.46
160 0.47
161 0.45
162 0.44
163 0.46
164 0.39
165 0.32
166 0.35
167 0.31
168 0.3
169 0.33
170 0.32
171 0.28
172 0.28
173 0.27
174 0.21
175 0.17
176 0.16
177 0.13
178 0.1
179 0.13
180 0.16
181 0.16
182 0.16
183 0.17
184 0.17
185 0.23
186 0.26
187 0.23
188 0.23
189 0.25
190 0.24
191 0.26
192 0.26
193 0.2
194 0.17
195 0.16
196 0.14
197 0.11
198 0.1
199 0.07
200 0.07
201 0.06
202 0.07
203 0.06
204 0.07
205 0.06
206 0.06
207 0.07
208 0.07
209 0.08
210 0.07
211 0.07
212 0.06
213 0.07
214 0.08
215 0.09
216 0.11
217 0.18
218 0.21
219 0.24
220 0.3
221 0.36
222 0.39
223 0.47
224 0.48
225 0.42
226 0.41
227 0.4
228 0.35
229 0.32
230 0.29
231 0.21
232 0.18
233 0.18
234 0.18
235 0.16
236 0.2
237 0.19
238 0.2
239 0.21
240 0.21
241 0.22
242 0.21
243 0.23
244 0.18
245 0.15
246 0.14
247 0.11
248 0.1
249 0.08
250 0.09
251 0.11
252 0.13
253 0.15
254 0.24
255 0.33
256 0.37
257 0.41
258 0.42
259 0.44
260 0.46
261 0.5
262 0.47
263 0.48
264 0.46
265 0.48
266 0.49
267 0.49
268 0.46
269 0.41
270 0.37
271 0.28
272 0.28
273 0.22
274 0.26
275 0.2
276 0.19
277 0.21
278 0.24
279 0.23
280 0.25
281 0.26
282 0.21
283 0.2
284 0.2
285 0.16
286 0.13
287 0.15
288 0.13
289 0.12
290 0.14
291 0.13
292 0.13
293 0.13
294 0.12
295 0.11
296 0.11
297 0.12
298 0.11
299 0.12
300 0.13
301 0.14
302 0.17
303 0.16
304 0.17
305 0.15
306 0.13
307 0.13
308 0.15
309 0.16
310 0.17
311 0.21
312 0.21
313 0.23
314 0.24
315 0.24
316 0.24
317 0.22
318 0.18
319 0.14
320 0.14
321 0.16
322 0.19
323 0.22
324 0.23
325 0.27
326 0.28
327 0.29
328 0.32
329 0.36
330 0.43
331 0.51
332 0.59
333 0.65
334 0.73
335 0.78
336 0.84
337 0.87
338 0.86
339 0.85
340 0.85
341 0.85
342 0.85
343 0.84
344 0.77
345 0.68
346 0.63
347 0.54
348 0.45
349 0.37
350 0.32
351 0.31
352 0.32
353 0.3
354 0.28
355 0.32