Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420J1R7

Protein Details
Accession A0A420J1R7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-96QVPLCSCHMKHCRKRRRVSLRIIGGEPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MRDKDLRPTMVAKLIRPEYKMNVWNKKVTNTNTVCKSEYRVEMHHVRMMKDLSAKTNRLDQLMIRANRKQVPLCSCHMKHCRKRRRVSLRIIGGEPYDRKLSRTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.41
4 0.41
5 0.38
6 0.43
7 0.48
8 0.49
9 0.52
10 0.53
11 0.57
12 0.55
13 0.55
14 0.56
15 0.53
16 0.54
17 0.49
18 0.52
19 0.51
20 0.51
21 0.48
22 0.41
23 0.41
24 0.36
25 0.36
26 0.32
27 0.28
28 0.31
29 0.34
30 0.35
31 0.33
32 0.3
33 0.26
34 0.25
35 0.24
36 0.2
37 0.19
38 0.18
39 0.2
40 0.22
41 0.23
42 0.21
43 0.26
44 0.26
45 0.23
46 0.23
47 0.18
48 0.22
49 0.29
50 0.31
51 0.28
52 0.3
53 0.33
54 0.36
55 0.39
56 0.34
57 0.32
58 0.34
59 0.34
60 0.37
61 0.42
62 0.4
63 0.46
64 0.53
65 0.58
66 0.63
67 0.7
68 0.77
69 0.78
70 0.87
71 0.89
72 0.9
73 0.89
74 0.89
75 0.88
76 0.86
77 0.81
78 0.72
79 0.62
80 0.53
81 0.5
82 0.41
83 0.34
84 0.32
85 0.28
86 0.29