Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420I961

Protein Details
Accession A0A420I961    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-50AAARRNEKLSRRNPDRLQKQLDHydrophilic
156-176VLDKWYQKRREKKGIFNDKKDBasic
NLS Segment(s)
PositionSequence
13-41QRKAEKAKAIKKSKAEAAARRNEKLSRRN
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019007  WW_dom-bd_prot_11  
Gene Ontology GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF09429  Wbp11  
Amino Acid Sequences MPKEKSINPAQAQRKAEKAKAIKKSKAEAAARRNEKLSRRNPDRLQKQLDELKAIESGGGRLTNHEKNLRDGLEKELRAVLKARDSIGNSAQTCGTGLKKNFEGNFHNERNEKTGCIALGKRRRELSESSDDSDVPEDVKHIPMPRDTPPPIPKDVLDKWYQKRREKKGIFNDKKDSNTNLIPLGDNARNLGRANGNTEESMETEPKLQSQTVYEAKPVIRDLRKEAVAFVPTVVQTKIEKSKGVVEPEEAEELEKEGYLPIVKPQVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.61
4 0.61
5 0.62
6 0.63
7 0.68
8 0.74
9 0.72
10 0.71
11 0.74
12 0.71
13 0.71
14 0.69
15 0.68
16 0.68
17 0.71
18 0.7
19 0.66
20 0.64
21 0.61
22 0.61
23 0.62
24 0.62
25 0.62
26 0.66
27 0.72
28 0.77
29 0.82
30 0.82
31 0.82
32 0.8
33 0.71
34 0.7
35 0.68
36 0.61
37 0.53
38 0.45
39 0.37
40 0.3
41 0.27
42 0.2
43 0.13
44 0.12
45 0.11
46 0.11
47 0.1
48 0.13
49 0.19
50 0.22
51 0.26
52 0.31
53 0.31
54 0.33
55 0.38
56 0.37
57 0.34
58 0.31
59 0.34
60 0.36
61 0.34
62 0.31
63 0.3
64 0.28
65 0.27
66 0.28
67 0.22
68 0.19
69 0.21
70 0.21
71 0.21
72 0.22
73 0.24
74 0.25
75 0.29
76 0.24
77 0.24
78 0.22
79 0.19
80 0.18
81 0.16
82 0.16
83 0.16
84 0.17
85 0.19
86 0.21
87 0.25
88 0.26
89 0.28
90 0.3
91 0.31
92 0.38
93 0.36
94 0.38
95 0.36
96 0.35
97 0.36
98 0.33
99 0.26
100 0.19
101 0.19
102 0.15
103 0.16
104 0.18
105 0.21
106 0.29
107 0.31
108 0.33
109 0.34
110 0.35
111 0.35
112 0.36
113 0.34
114 0.35
115 0.34
116 0.33
117 0.31
118 0.3
119 0.27
120 0.25
121 0.18
122 0.1
123 0.07
124 0.06
125 0.07
126 0.08
127 0.09
128 0.1
129 0.12
130 0.13
131 0.16
132 0.18
133 0.24
134 0.25
135 0.31
136 0.34
137 0.36
138 0.37
139 0.35
140 0.32
141 0.32
142 0.33
143 0.3
144 0.3
145 0.34
146 0.39
147 0.47
148 0.54
149 0.56
150 0.63
151 0.68
152 0.74
153 0.73
154 0.76
155 0.78
156 0.81
157 0.82
158 0.79
159 0.77
160 0.7
161 0.68
162 0.61
163 0.53
164 0.46
165 0.39
166 0.34
167 0.28
168 0.24
169 0.21
170 0.18
171 0.2
172 0.17
173 0.15
174 0.15
175 0.14
176 0.15
177 0.15
178 0.17
179 0.16
180 0.15
181 0.2
182 0.21
183 0.21
184 0.2
185 0.21
186 0.19
187 0.17
188 0.19
189 0.15
190 0.13
191 0.15
192 0.15
193 0.15
194 0.16
195 0.15
196 0.13
197 0.15
198 0.21
199 0.23
200 0.24
201 0.23
202 0.25
203 0.25
204 0.26
205 0.27
206 0.28
207 0.29
208 0.3
209 0.35
210 0.39
211 0.42
212 0.4
213 0.39
214 0.35
215 0.32
216 0.29
217 0.23
218 0.19
219 0.17
220 0.19
221 0.17
222 0.15
223 0.15
224 0.21
225 0.28
226 0.28
227 0.29
228 0.29
229 0.38
230 0.41
231 0.45
232 0.41
233 0.35
234 0.36
235 0.37
236 0.37
237 0.28
238 0.24
239 0.19
240 0.18
241 0.16
242 0.13
243 0.1
244 0.08
245 0.1
246 0.1
247 0.11
248 0.15