Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I3I9

Protein Details
Accession A0A420I3I9   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
213-238DEYVKAKLEKKQKKLQEKKNASPKAAHydrophilic
NLS Segment(s)
PositionSequence
219-232KLEKKQKKLQEKKN
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSKNQRSLFQGIPTYEIYARFSPGTLDAINVIRKQYVNKQIYPRDIGIRLYKNILKNDKSTSAMNSKLATLAKSVAPFQVELLKPFRNMAAEKKKYLPSVYYEIKKYPFNLLCADLRILFNSLSRRRDCPVTTTSFKIGLTGKLESFEESDRIVKELLAIDIPKPLKFDAFVLATRPNTKPLSELEEEIKEFPFTATDEEFGTFLKEITVKRDEYVKAKLEKKQKKLQEKKNASPKAAEASDLTKDQDATKLEDNLKADDEPEKLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.29
4 0.27
5 0.23
6 0.24
7 0.21
8 0.2
9 0.18
10 0.18
11 0.2
12 0.15
13 0.15
14 0.15
15 0.18
16 0.22
17 0.21
18 0.21
19 0.2
20 0.21
21 0.25
22 0.32
23 0.39
24 0.41
25 0.46
26 0.54
27 0.59
28 0.63
29 0.63
30 0.57
31 0.52
32 0.48
33 0.45
34 0.44
35 0.41
36 0.38
37 0.38
38 0.4
39 0.4
40 0.45
41 0.49
42 0.45
43 0.44
44 0.48
45 0.46
46 0.45
47 0.41
48 0.38
49 0.36
50 0.35
51 0.33
52 0.29
53 0.25
54 0.25
55 0.25
56 0.2
57 0.16
58 0.15
59 0.15
60 0.15
61 0.16
62 0.14
63 0.14
64 0.13
65 0.13
66 0.18
67 0.17
68 0.18
69 0.21
70 0.22
71 0.21
72 0.22
73 0.22
74 0.17
75 0.19
76 0.26
77 0.33
78 0.36
79 0.38
80 0.42
81 0.44
82 0.43
83 0.43
84 0.35
85 0.29
86 0.32
87 0.35
88 0.35
89 0.33
90 0.34
91 0.35
92 0.35
93 0.31
94 0.32
95 0.29
96 0.27
97 0.27
98 0.27
99 0.25
100 0.25
101 0.24
102 0.17
103 0.15
104 0.13
105 0.12
106 0.1
107 0.11
108 0.17
109 0.21
110 0.25
111 0.26
112 0.28
113 0.29
114 0.33
115 0.31
116 0.29
117 0.28
118 0.3
119 0.3
120 0.3
121 0.29
122 0.27
123 0.26
124 0.23
125 0.2
126 0.16
127 0.15
128 0.15
129 0.13
130 0.13
131 0.13
132 0.12
133 0.12
134 0.11
135 0.1
136 0.09
137 0.11
138 0.1
139 0.11
140 0.11
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.08
147 0.08
148 0.12
149 0.13
150 0.12
151 0.13
152 0.13
153 0.12
154 0.12
155 0.13
156 0.12
157 0.13
158 0.13
159 0.15
160 0.17
161 0.18
162 0.21
163 0.21
164 0.22
165 0.21
166 0.21
167 0.21
168 0.2
169 0.26
170 0.24
171 0.25
172 0.23
173 0.24
174 0.25
175 0.24
176 0.22
177 0.16
178 0.14
179 0.13
180 0.1
181 0.09
182 0.11
183 0.1
184 0.11
185 0.12
186 0.12
187 0.12
188 0.11
189 0.12
190 0.09
191 0.08
192 0.09
193 0.11
194 0.11
195 0.17
196 0.21
197 0.2
198 0.21
199 0.27
200 0.29
201 0.3
202 0.36
203 0.38
204 0.42
205 0.46
206 0.52
207 0.57
208 0.64
209 0.68
210 0.71
211 0.74
212 0.77
213 0.83
214 0.86
215 0.87
216 0.88
217 0.89
218 0.9
219 0.87
220 0.78
221 0.71
222 0.63
223 0.59
224 0.49
225 0.41
226 0.32
227 0.29
228 0.3
229 0.28
230 0.27
231 0.2
232 0.21
233 0.21
234 0.24
235 0.23
236 0.24
237 0.28
238 0.32
239 0.33
240 0.37
241 0.38
242 0.35
243 0.35
244 0.3
245 0.27
246 0.24