Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420IPK2

Protein Details
Accession A0A420IPK2   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-36VTDAQRQALRKRKREHPGHQNELIHydrophilic
NLS Segment(s)
PositionSequence
9-11KRK
17-26QRQALRKRKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR041188  HTH_ABP1_N  
Pfam View protein in Pfam  
PF18107  HTH_ABP1_N  
Amino Acid Sequences MELATAGRKRKAVTDAQRQALRKRKREHPGHQNELIALFKSQYYNTLNQSQVSKIISSSYDHLDFLDTNKDKCLLEVKRLSAGDWPDLEGALFEWQQRMQKNKAVITGDILKNQASKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.64
4 0.69
5 0.66
6 0.69
7 0.69
8 0.69
9 0.67
10 0.67
11 0.69
12 0.74
13 0.81
14 0.83
15 0.84
16 0.85
17 0.83
18 0.78
19 0.68
20 0.58
21 0.5
22 0.4
23 0.29
24 0.19
25 0.12
26 0.1
27 0.1
28 0.1
29 0.12
30 0.14
31 0.16
32 0.2
33 0.24
34 0.24
35 0.24
36 0.26
37 0.22
38 0.21
39 0.19
40 0.16
41 0.11
42 0.11
43 0.1
44 0.1
45 0.11
46 0.12
47 0.12
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.18
54 0.16
55 0.16
56 0.17
57 0.18
58 0.17
59 0.18
60 0.25
61 0.18
62 0.25
63 0.29
64 0.29
65 0.33
66 0.33
67 0.33
68 0.29
69 0.29
70 0.24
71 0.21
72 0.2
73 0.15
74 0.15
75 0.14
76 0.1
77 0.09
78 0.09
79 0.09
80 0.08
81 0.1
82 0.12
83 0.17
84 0.22
85 0.27
86 0.29
87 0.34
88 0.39
89 0.41
90 0.45
91 0.43
92 0.39
93 0.39
94 0.43
95 0.4
96 0.37
97 0.35
98 0.3