Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HFY9

Protein Details
Accession A0A420HFY9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MTRPYWKKDKDLQPLKRGRGRPKGSRNKVHLIDBasic
NLS Segment(s)
PositionSequence
14-27PLKRGRGRPKGSRN
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
Amino Acid Sequences MTRPYWKKDKDLQPLKRGRGRPKGSRNKVHLIDNYDPDNFEGQFVQGNKSENNNNFDTQILNDNDITSLHSMTFVSHKEQADRQLSLKLRREGKITAPGAPYEESDIIELEGLRNQEVMEFVTYDPNKHMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.83
4 0.81
5 0.79
6 0.79
7 0.79
8 0.79
9 0.81
10 0.84
11 0.85
12 0.87
13 0.84
14 0.82
15 0.77
16 0.74
17 0.67
18 0.63
19 0.57
20 0.51
21 0.47
22 0.38
23 0.34
24 0.29
25 0.26
26 0.18
27 0.15
28 0.11
29 0.09
30 0.12
31 0.12
32 0.14
33 0.14
34 0.16
35 0.16
36 0.19
37 0.24
38 0.24
39 0.28
40 0.28
41 0.26
42 0.25
43 0.24
44 0.22
45 0.17
46 0.19
47 0.15
48 0.14
49 0.13
50 0.13
51 0.13
52 0.12
53 0.12
54 0.07
55 0.07
56 0.05
57 0.06
58 0.06
59 0.06
60 0.08
61 0.09
62 0.11
63 0.15
64 0.16
65 0.18
66 0.2
67 0.26
68 0.27
69 0.27
70 0.26
71 0.28
72 0.32
73 0.37
74 0.43
75 0.42
76 0.44
77 0.44
78 0.47
79 0.42
80 0.43
81 0.45
82 0.39
83 0.37
84 0.33
85 0.32
86 0.31
87 0.29
88 0.25
89 0.19
90 0.18
91 0.14
92 0.14
93 0.14
94 0.11
95 0.11
96 0.11
97 0.08
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.09
104 0.1
105 0.11
106 0.1
107 0.11
108 0.11
109 0.2
110 0.21
111 0.21