Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420IMP3

Protein Details
Accession A0A420IMP3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-36TKTFTSPKIKRLPRNDEIKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, mito_nucl 14, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
IPR019815  Translation_initiation_fac_3_C  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF00707  IF3_C  
Amino Acid Sequences MTSSSLSIRKHSRAWSTKTFTSPKIKRLPRNDEIKEEIISVVDESGKISGPHRTAEFLEDFDFENKSLVTILEGNAEDGRYPLCRIMDRSALRQIEMTTLKSKGKKKGTPTKIIEMSWAVENHDLETKLRRLREFLEKGCNVNLLLQAKKRGRSVTQLEGENIIQKILETVEEAGGKQQKPPEGEILNTMDMSFTHKKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.66
4 0.67
5 0.69
6 0.67
7 0.64
8 0.66
9 0.64
10 0.63
11 0.66
12 0.7
13 0.71
14 0.77
15 0.8
16 0.77
17 0.82
18 0.77
19 0.73
20 0.7
21 0.63
22 0.53
23 0.44
24 0.36
25 0.26
26 0.22
27 0.15
28 0.1
29 0.08
30 0.07
31 0.06
32 0.07
33 0.08
34 0.08
35 0.09
36 0.14
37 0.15
38 0.17
39 0.18
40 0.19
41 0.19
42 0.22
43 0.22
44 0.18
45 0.18
46 0.16
47 0.16
48 0.15
49 0.15
50 0.12
51 0.11
52 0.09
53 0.09
54 0.08
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.08
65 0.08
66 0.08
67 0.06
68 0.07
69 0.08
70 0.09
71 0.1
72 0.13
73 0.16
74 0.23
75 0.24
76 0.26
77 0.31
78 0.3
79 0.29
80 0.27
81 0.24
82 0.21
83 0.2
84 0.19
85 0.15
86 0.17
87 0.2
88 0.25
89 0.3
90 0.34
91 0.41
92 0.44
93 0.51
94 0.6
95 0.64
96 0.68
97 0.67
98 0.66
99 0.61
100 0.56
101 0.48
102 0.38
103 0.32
104 0.25
105 0.2
106 0.14
107 0.13
108 0.13
109 0.12
110 0.14
111 0.13
112 0.11
113 0.15
114 0.19
115 0.22
116 0.24
117 0.24
118 0.24
119 0.28
120 0.37
121 0.39
122 0.38
123 0.44
124 0.42
125 0.43
126 0.42
127 0.39
128 0.28
129 0.24
130 0.24
131 0.19
132 0.2
133 0.22
134 0.29
135 0.32
136 0.36
137 0.38
138 0.38
139 0.37
140 0.42
141 0.46
142 0.46
143 0.48
144 0.46
145 0.43
146 0.42
147 0.39
148 0.34
149 0.28
150 0.19
151 0.13
152 0.11
153 0.11
154 0.09
155 0.09
156 0.07
157 0.08
158 0.1
159 0.11
160 0.11
161 0.16
162 0.22
163 0.22
164 0.24
165 0.28
166 0.3
167 0.33
168 0.36
169 0.38
170 0.34
171 0.35
172 0.36
173 0.36
174 0.32
175 0.29
176 0.26
177 0.18
178 0.16
179 0.22
180 0.26