Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HEZ4

Protein Details
Accession A0A420HEZ4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-99NLDASEPKRKRKRKNEEPPVPCLICNRNHWKRHCPQKPKKGNANEAETPHydrophilic
NLS Segment(s)
PositionSequence
57-64PKRKRKRK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR024675  eIF3g_N  
Pfam View protein in Pfam  
PF12353  eIF3g  
Amino Acid Sequences MDTRQGRKTARARANLTPCPIQTTTAPIAEEPIVVSPLVLEAPVTRKETGNLDASEPKRKRKRKNEEPPVPCLICNRNHWKRHCPQKPKKGNANEAETPREKSVRDNKEPQHETC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.67
4 0.6
5 0.52
6 0.49
7 0.44
8 0.37
9 0.29
10 0.3
11 0.28
12 0.25
13 0.25
14 0.19
15 0.2
16 0.18
17 0.18
18 0.12
19 0.1
20 0.08
21 0.08
22 0.07
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.07
30 0.11
31 0.13
32 0.14
33 0.14
34 0.16
35 0.18
36 0.2
37 0.21
38 0.19
39 0.18
40 0.24
41 0.25
42 0.34
43 0.33
44 0.39
45 0.45
46 0.53
47 0.62
48 0.67
49 0.77
50 0.78
51 0.88
52 0.9
53 0.91
54 0.86
55 0.81
56 0.76
57 0.65
58 0.54
59 0.47
60 0.4
61 0.34
62 0.37
63 0.42
64 0.45
65 0.52
66 0.58
67 0.63
68 0.68
69 0.75
70 0.77
71 0.78
72 0.8
73 0.84
74 0.89
75 0.89
76 0.9
77 0.88
78 0.88
79 0.83
80 0.8
81 0.76
82 0.69
83 0.66
84 0.59
85 0.53
86 0.47
87 0.43
88 0.35
89 0.38
90 0.45
91 0.48
92 0.54
93 0.6
94 0.64
95 0.72