Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I860

Protein Details
Accession A0A420I860    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28VSAKKHVPIVKKHTKRFNRHQSDAYKCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKHTKRFNRHQSDAYKCVDASWRKPKGIDNRVRRRFAGQIAMPSIGYGSNKKTRHMMPSGHKAFLVHNCRDIDLLLMHNKTFAAEISHSVSSRKRIDMVQRAKELGIKVTNPKARITTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.86
4 0.87
5 0.89
6 0.87
7 0.84
8 0.83
9 0.81
10 0.79
11 0.74
12 0.66
13 0.56
14 0.46
15 0.41
16 0.41
17 0.37
18 0.37
19 0.42
20 0.45
21 0.44
22 0.46
23 0.52
24 0.55
25 0.6
26 0.61
27 0.62
28 0.68
29 0.75
30 0.77
31 0.7
32 0.63
33 0.57
34 0.5
35 0.46
36 0.36
37 0.31
38 0.3
39 0.29
40 0.25
41 0.21
42 0.18
43 0.11
44 0.11
45 0.09
46 0.11
47 0.19
48 0.2
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.33
62 0.35
63 0.35
64 0.25
65 0.27
66 0.27
67 0.27
68 0.27
69 0.25
70 0.18
71 0.13
72 0.14
73 0.14
74 0.14
75 0.13
76 0.13
77 0.13
78 0.12
79 0.12
80 0.1
81 0.09
82 0.09
83 0.11
84 0.15
85 0.17
86 0.17
87 0.19
88 0.21
89 0.24
90 0.27
91 0.27
92 0.25
93 0.29
94 0.38
95 0.47
96 0.53
97 0.55
98 0.55
99 0.54
100 0.53
101 0.51
102 0.43
103 0.38
104 0.33
105 0.28
106 0.32
107 0.39
108 0.44
109 0.42
110 0.44
111 0.42