Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HHB3

Protein Details
Accession A0A420HHB3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-25VQTPEQRKRNERFAKQQNAKRGKPHydrophilic
NLS Segment(s)
PositionSequence
21-22KR
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MVQTPEQRKRNERFAKQQNAKRGKPAVESKTKLEFKSPLNPILADILSHQNDSTVNKYNKADMVIFSLQVYWRLSLLVAWRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.84
4 0.84
5 0.84
6 0.83
7 0.75
8 0.72
9 0.67
10 0.58
11 0.56
12 0.58
13 0.55
14 0.55
15 0.56
16 0.52
17 0.56
18 0.57
19 0.5
20 0.44
21 0.4
22 0.34
23 0.41
24 0.39
25 0.32
26 0.3
27 0.29
28 0.26
29 0.24
30 0.21
31 0.12
32 0.11
33 0.13
34 0.13
35 0.13
36 0.12
37 0.11
38 0.12
39 0.14
40 0.16
41 0.21
42 0.21
43 0.25
44 0.26
45 0.28
46 0.28
47 0.29
48 0.26
49 0.18
50 0.23
51 0.2
52 0.2
53 0.18
54 0.17
55 0.15
56 0.18
57 0.18
58 0.12
59 0.12
60 0.12
61 0.12
62 0.12
63 0.17