Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420H7P9

Protein Details
Accession A0A420H7P9    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
111-130IPSLVFKQKGKPPRRNPGEGHydrophilic
262-286LTPPMQYARKRRFRKRLHKTQIEAMHydrophilic
NLS Segment(s)
PositionSequence
52-71KKNKIGRAPIPSPKIIESRK
270-278RKRRFRKRL
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
CDD cd08047  TAF7  
Amino Acid Sequences MSGISLKLKLNKGINAESNAPGSTPAPPSGTRIKIRSSLPPTPIPNDQPIAKKNKIGRAPIPSPKIIESRKRVKDDSDSEEKTSYQARAPLKRVKIQVGAGGPPLAKTSTIPSLVFKQKGKPPRRNPGEGYDSEASDREEDPAIEEQFIIRILDADDHCNYLRQIISEKKIGVSRDLNLKFLDPDGRRAIFIIRGCMYAATLVDLPCILEAMKSWDKRGWWKSADISQMLLVFARIKTEAEAMTIPLPPVVDPVTHQYPHGLTPPMQYARKRRFRKRLHKTQIEAMEDAVEKLLKEDEKAIHTTYEIVDPETEYTRASEAFSQPSSPACANYDANSGDEYSGENTGELGYYNHMPDGQQNPEVPDDDLDLALEAELEAAMDEEYDMGTPSNSLPTEQVNRGSGAGDTGAEEEDSGDESLDDDDLEENGERTVEKFEDAEQERRVQEAAVRDDILDLEDRISANLAAQSTQSNPILRKRLEEGARKLRAELQLKKSSIGEGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.48
4 0.43
5 0.4
6 0.35
7 0.3
8 0.24
9 0.2
10 0.2
11 0.19
12 0.19
13 0.21
14 0.22
15 0.27
16 0.34
17 0.4
18 0.42
19 0.43
20 0.46
21 0.49
22 0.51
23 0.56
24 0.56
25 0.56
26 0.55
27 0.59
28 0.59
29 0.57
30 0.6
31 0.54
32 0.52
33 0.48
34 0.47
35 0.47
36 0.5
37 0.54
38 0.51
39 0.53
40 0.54
41 0.59
42 0.62
43 0.61
44 0.61
45 0.62
46 0.67
47 0.69
48 0.67
49 0.61
50 0.56
51 0.53
52 0.54
53 0.52
54 0.54
55 0.54
56 0.59
57 0.66
58 0.7
59 0.68
60 0.65
61 0.67
62 0.64
63 0.63
64 0.62
65 0.57
66 0.52
67 0.51
68 0.46
69 0.39
70 0.36
71 0.3
72 0.23
73 0.26
74 0.31
75 0.38
76 0.44
77 0.51
78 0.53
79 0.58
80 0.59
81 0.58
82 0.56
83 0.5
84 0.48
85 0.42
86 0.38
87 0.32
88 0.29
89 0.24
90 0.19
91 0.18
92 0.14
93 0.11
94 0.1
95 0.13
96 0.16
97 0.19
98 0.19
99 0.2
100 0.27
101 0.34
102 0.38
103 0.36
104 0.39
105 0.44
106 0.54
107 0.61
108 0.65
109 0.68
110 0.74
111 0.8
112 0.8
113 0.77
114 0.75
115 0.72
116 0.62
117 0.59
118 0.49
119 0.42
120 0.35
121 0.32
122 0.24
123 0.19
124 0.18
125 0.13
126 0.12
127 0.11
128 0.13
129 0.17
130 0.16
131 0.15
132 0.14
133 0.12
134 0.12
135 0.13
136 0.1
137 0.06
138 0.06
139 0.06
140 0.1
141 0.11
142 0.13
143 0.13
144 0.15
145 0.16
146 0.17
147 0.16
148 0.14
149 0.14
150 0.12
151 0.17
152 0.21
153 0.24
154 0.26
155 0.26
156 0.26
157 0.29
158 0.29
159 0.28
160 0.24
161 0.24
162 0.3
163 0.31
164 0.3
165 0.27
166 0.27
167 0.23
168 0.22
169 0.27
170 0.18
171 0.22
172 0.25
173 0.25
174 0.24
175 0.24
176 0.24
177 0.21
178 0.21
179 0.2
180 0.16
181 0.16
182 0.16
183 0.16
184 0.14
185 0.1
186 0.09
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.06
193 0.06
194 0.06
195 0.04
196 0.03
197 0.04
198 0.11
199 0.17
200 0.17
201 0.19
202 0.21
203 0.22
204 0.31
205 0.35
206 0.34
207 0.31
208 0.33
209 0.34
210 0.37
211 0.39
212 0.31
213 0.27
214 0.21
215 0.19
216 0.17
217 0.14
218 0.09
219 0.07
220 0.07
221 0.07
222 0.07
223 0.06
224 0.07
225 0.08
226 0.08
227 0.08
228 0.08
229 0.08
230 0.09
231 0.09
232 0.08
233 0.07
234 0.07
235 0.06
236 0.07
237 0.06
238 0.05
239 0.06
240 0.11
241 0.14
242 0.14
243 0.14
244 0.14
245 0.15
246 0.16
247 0.18
248 0.14
249 0.12
250 0.13
251 0.18
252 0.21
253 0.24
254 0.26
255 0.33
256 0.42
257 0.52
258 0.59
259 0.64
260 0.71
261 0.79
262 0.86
263 0.88
264 0.89
265 0.89
266 0.89
267 0.82
268 0.78
269 0.74
270 0.65
271 0.54
272 0.43
273 0.34
274 0.26
275 0.22
276 0.15
277 0.09
278 0.06
279 0.06
280 0.08
281 0.07
282 0.07
283 0.1
284 0.12
285 0.15
286 0.17
287 0.17
288 0.15
289 0.15
290 0.16
291 0.13
292 0.14
293 0.11
294 0.1
295 0.1
296 0.1
297 0.11
298 0.12
299 0.11
300 0.09
301 0.09
302 0.09
303 0.1
304 0.1
305 0.12
306 0.12
307 0.15
308 0.15
309 0.15
310 0.15
311 0.16
312 0.18
313 0.15
314 0.14
315 0.13
316 0.16
317 0.16
318 0.17
319 0.19
320 0.16
321 0.17
322 0.16
323 0.15
324 0.11
325 0.11
326 0.1
327 0.08
328 0.09
329 0.08
330 0.07
331 0.07
332 0.07
333 0.07
334 0.06
335 0.06
336 0.07
337 0.08
338 0.08
339 0.09
340 0.09
341 0.09
342 0.13
343 0.18
344 0.19
345 0.2
346 0.21
347 0.23
348 0.24
349 0.25
350 0.2
351 0.16
352 0.15
353 0.13
354 0.12
355 0.1
356 0.09
357 0.07
358 0.07
359 0.06
360 0.04
361 0.03
362 0.03
363 0.03
364 0.03
365 0.03
366 0.03
367 0.03
368 0.03
369 0.03
370 0.03
371 0.04
372 0.04
373 0.04
374 0.04
375 0.05
376 0.06
377 0.09
378 0.09
379 0.1
380 0.11
381 0.16
382 0.22
383 0.24
384 0.26
385 0.24
386 0.25
387 0.25
388 0.24
389 0.19
390 0.14
391 0.12
392 0.09
393 0.08
394 0.08
395 0.08
396 0.07
397 0.07
398 0.06
399 0.06
400 0.08
401 0.07
402 0.07
403 0.06
404 0.07
405 0.07
406 0.07
407 0.07
408 0.05
409 0.06
410 0.06
411 0.08
412 0.07
413 0.07
414 0.07
415 0.08
416 0.08
417 0.08
418 0.12
419 0.11
420 0.12
421 0.12
422 0.14
423 0.23
424 0.27
425 0.32
426 0.31
427 0.36
428 0.35
429 0.35
430 0.34
431 0.25
432 0.25
433 0.27
434 0.29
435 0.26
436 0.26
437 0.25
438 0.26
439 0.25
440 0.23
441 0.17
442 0.12
443 0.1
444 0.11
445 0.11
446 0.11
447 0.12
448 0.11
449 0.1
450 0.13
451 0.12
452 0.11
453 0.12
454 0.14
455 0.15
456 0.2
457 0.21
458 0.23
459 0.27
460 0.34
461 0.43
462 0.42
463 0.44
464 0.44
465 0.51
466 0.55
467 0.61
468 0.62
469 0.64
470 0.7
471 0.66
472 0.63
473 0.6
474 0.6
475 0.6
476 0.6
477 0.58
478 0.6
479 0.61
480 0.61
481 0.55
482 0.49