Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420J7L1

Protein Details
Accession A0A420J7L1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-151VELEKAKRALKRRKNSTTSKTSRTNHydrophilic
NLS Segment(s)
PositionSequence
132-140AKRALKRRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MYFSYAFGSQGAQGTSPSEAIEIPSPSTGFSSVISPTCAFPSWPRRSSLSNSSETSDADYQHQQSTSYITDEELFPPNYRISPCTPTYHFTSHSPASLSRSELSTEPRPPPCQVVQNSARDLVRELVELEKAKRALKRRKNSTTSKTSRTNSGASKYMSPIME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.11
5 0.09
6 0.09
7 0.1
8 0.13
9 0.13
10 0.13
11 0.14
12 0.14
13 0.14
14 0.15
15 0.14
16 0.11
17 0.11
18 0.11
19 0.12
20 0.13
21 0.15
22 0.14
23 0.14
24 0.15
25 0.15
26 0.15
27 0.2
28 0.29
29 0.35
30 0.37
31 0.39
32 0.4
33 0.44
34 0.49
35 0.51
36 0.46
37 0.42
38 0.41
39 0.4
40 0.37
41 0.33
42 0.31
43 0.23
44 0.19
45 0.17
46 0.18
47 0.18
48 0.19
49 0.19
50 0.16
51 0.15
52 0.17
53 0.15
54 0.13
55 0.11
56 0.1
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.12
63 0.13
64 0.13
65 0.14
66 0.14
67 0.14
68 0.15
69 0.18
70 0.2
71 0.22
72 0.24
73 0.25
74 0.29
75 0.29
76 0.28
77 0.25
78 0.28
79 0.25
80 0.24
81 0.23
82 0.19
83 0.21
84 0.2
85 0.2
86 0.15
87 0.15
88 0.16
89 0.16
90 0.21
91 0.22
92 0.25
93 0.29
94 0.32
95 0.34
96 0.34
97 0.38
98 0.35
99 0.38
100 0.36
101 0.4
102 0.42
103 0.44
104 0.44
105 0.42
106 0.39
107 0.31
108 0.31
109 0.25
110 0.19
111 0.15
112 0.15
113 0.13
114 0.16
115 0.18
116 0.18
117 0.2
118 0.22
119 0.25
120 0.29
121 0.38
122 0.45
123 0.54
124 0.64
125 0.69
126 0.78
127 0.83
128 0.87
129 0.87
130 0.87
131 0.84
132 0.81
133 0.79
134 0.72
135 0.71
136 0.65
137 0.62
138 0.57
139 0.54
140 0.52
141 0.46
142 0.47
143 0.42