Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420J526

Protein Details
Accession A0A420J526   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPKGKSTGRNPRSRSEKKKKDRHYRGICLITEBasic
NLS Segment(s)
PositionSequence
4-22GKSTGRNPRSRSEKKKKDR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKGKSTGRNPRSRSEKKKKDRHYRGICLITEADPNAPKRSLSAYMIFANEQRENVRDENPGITFGQVGKVLGKRWKDLDDKQRSPYELKAAEDKKRYLDEKANYNPDAEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.85
5 0.92
6 0.93
7 0.94
8 0.94
9 0.94
10 0.93
11 0.9
12 0.88
13 0.84
14 0.73
15 0.64
16 0.54
17 0.44
18 0.36
19 0.27
20 0.21
21 0.18
22 0.2
23 0.2
24 0.19
25 0.18
26 0.17
27 0.2
28 0.21
29 0.2
30 0.2
31 0.2
32 0.21
33 0.22
34 0.21
35 0.19
36 0.19
37 0.17
38 0.15
39 0.13
40 0.13
41 0.15
42 0.16
43 0.16
44 0.14
45 0.14
46 0.15
47 0.15
48 0.15
49 0.12
50 0.11
51 0.09
52 0.08
53 0.09
54 0.08
55 0.08
56 0.09
57 0.1
58 0.13
59 0.18
60 0.19
61 0.2
62 0.23
63 0.28
64 0.32
65 0.38
66 0.46
67 0.52
68 0.54
69 0.57
70 0.58
71 0.55
72 0.52
73 0.47
74 0.44
75 0.37
76 0.35
77 0.39
78 0.41
79 0.46
80 0.49
81 0.47
82 0.44
83 0.47
84 0.47
85 0.44
86 0.47
87 0.46
88 0.5
89 0.57
90 0.59
91 0.54
92 0.52
93 0.46
94 0.39
95 0.38