Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HDD8

Protein Details
Accession A0A420HDD8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AKSKNSSQHNQSKKAHRNGIKKPKTSRHydrophilic
NLS Segment(s)
PositionSequence
14-58KKAHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.83
9 0.8
10 0.79
11 0.79
12 0.79
13 0.76
14 0.75
15 0.72
16 0.7
17 0.68
18 0.65
19 0.6
20 0.57
21 0.54
22 0.55
23 0.53
24 0.53
25 0.55
26 0.58
27 0.64
28 0.64
29 0.7
30 0.63
31 0.68
32 0.63
33 0.64
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.38
41 0.31
42 0.31
43 0.34
44 0.38
45 0.44