Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420JAW5

Protein Details
Accession A0A420JAW5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-97FECEKENHRIHKNCKNCKHRVCENCIKGHydrophilic
NLS Segment(s)
PositionSequence
33-39RKGIVKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MAEIKRSTRKEEIQSGCGIFGRDSSTVSRPPPRKGIVKKTKRYAIFLMNHVKKGEVPWTQWYCCHVVNGFECEKENHRIHKNCKNCKHRVCENCIKGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.44
4 0.38
5 0.31
6 0.21
7 0.16
8 0.16
9 0.13
10 0.14
11 0.16
12 0.18
13 0.21
14 0.25
15 0.33
16 0.34
17 0.38
18 0.43
19 0.44
20 0.5
21 0.55
22 0.62
23 0.64
24 0.7
25 0.74
26 0.75
27 0.78
28 0.7
29 0.66
30 0.58
31 0.55
32 0.48
33 0.45
34 0.47
35 0.42
36 0.41
37 0.37
38 0.34
39 0.26
40 0.24
41 0.25
42 0.18
43 0.18
44 0.25
45 0.29
46 0.29
47 0.3
48 0.31
49 0.28
50 0.26
51 0.26
52 0.18
53 0.18
54 0.19
55 0.23
56 0.22
57 0.19
58 0.2
59 0.21
60 0.24
61 0.28
62 0.3
63 0.34
64 0.42
65 0.5
66 0.57
67 0.65
68 0.71
69 0.74
70 0.81
71 0.82
72 0.83
73 0.84
74 0.85
75 0.85
76 0.84
77 0.83
78 0.84
79 0.79