Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420IN33

Protein Details
Accession A0A420IN33    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
300-322EYDSTKKSSKKTNTSRQEEKEGQHydrophilic
NLS Segment(s)
PositionSequence
151-162KSKKIPHFIKRK
Subcellular Location(s) nucl 23.5, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR003738  SRAP  
IPR036590  SRAP-like  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0006974  P:DNA damage response  
GO:0018142  P:protein-DNA covalent cross-linking  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02586  SRAP  
Amino Acid Sequences MCGRYALGYRPDEIRTKLRNDGINIHEIPDNKSGEALLPNYNLAPGNFGLVCLAQKWSKTLPQLAPGQAQDTLTQEDLSDTSQYDVQLKLQIMKWGLVPSWAKQMPDYGSLFKTINCRDDSLQVNTGMWTSMKCTKRCVVIAMGYYEWLKKSKKIPHFIKRKDGKPLFLAGLYDCVQLEGSNEKLFTYTIITTNANKQSNFLHDRMPAILDNNSDDLHTWLDINRSIWSKDLQYLLKPYDGDLEIYPVSNDVGKLSNNSPRLVIPVTSTENKMNIANFFRKGEPKIQRVSAASNVEKGTEYDSTKKSSKKTNTSRQEEKEGQRLIEFENEKETPLILSLKDHQLDKKRHLSESLDFTPRKKVHLISSPSKPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.47
4 0.52
5 0.54
6 0.56
7 0.55
8 0.58
9 0.53
10 0.54
11 0.49
12 0.44
13 0.4
14 0.36
15 0.36
16 0.34
17 0.32
18 0.24
19 0.24
20 0.22
21 0.22
22 0.24
23 0.22
24 0.19
25 0.18
26 0.19
27 0.19
28 0.2
29 0.19
30 0.15
31 0.16
32 0.12
33 0.14
34 0.13
35 0.13
36 0.13
37 0.12
38 0.13
39 0.1
40 0.14
41 0.12
42 0.13
43 0.17
44 0.2
45 0.25
46 0.29
47 0.36
48 0.35
49 0.39
50 0.45
51 0.44
52 0.44
53 0.39
54 0.37
55 0.3
56 0.28
57 0.23
58 0.2
59 0.19
60 0.16
61 0.15
62 0.13
63 0.12
64 0.12
65 0.12
66 0.11
67 0.09
68 0.1
69 0.11
70 0.12
71 0.13
72 0.13
73 0.13
74 0.17
75 0.17
76 0.19
77 0.19
78 0.23
79 0.22
80 0.22
81 0.22
82 0.19
83 0.19
84 0.2
85 0.2
86 0.18
87 0.26
88 0.27
89 0.25
90 0.24
91 0.28
92 0.25
93 0.27
94 0.28
95 0.22
96 0.21
97 0.23
98 0.23
99 0.21
100 0.26
101 0.24
102 0.27
103 0.25
104 0.27
105 0.26
106 0.31
107 0.33
108 0.31
109 0.31
110 0.26
111 0.25
112 0.23
113 0.21
114 0.16
115 0.13
116 0.08
117 0.09
118 0.17
119 0.22
120 0.23
121 0.27
122 0.3
123 0.34
124 0.35
125 0.34
126 0.29
127 0.27
128 0.28
129 0.26
130 0.23
131 0.19
132 0.18
133 0.16
134 0.14
135 0.15
136 0.14
137 0.17
138 0.25
139 0.33
140 0.41
141 0.51
142 0.59
143 0.65
144 0.75
145 0.76
146 0.79
147 0.78
148 0.74
149 0.74
150 0.67
151 0.6
152 0.51
153 0.48
154 0.38
155 0.3
156 0.27
157 0.16
158 0.16
159 0.14
160 0.12
161 0.1
162 0.09
163 0.08
164 0.08
165 0.09
166 0.07
167 0.07
168 0.07
169 0.08
170 0.07
171 0.08
172 0.08
173 0.07
174 0.08
175 0.08
176 0.08
177 0.11
178 0.12
179 0.12
180 0.18
181 0.24
182 0.24
183 0.23
184 0.23
185 0.22
186 0.28
187 0.31
188 0.27
189 0.23
190 0.22
191 0.23
192 0.23
193 0.22
194 0.16
195 0.13
196 0.14
197 0.11
198 0.11
199 0.11
200 0.11
201 0.09
202 0.09
203 0.09
204 0.08
205 0.08
206 0.07
207 0.07
208 0.09
209 0.1
210 0.1
211 0.12
212 0.13
213 0.13
214 0.14
215 0.15
216 0.15
217 0.17
218 0.2
219 0.19
220 0.19
221 0.22
222 0.22
223 0.23
224 0.21
225 0.19
226 0.19
227 0.18
228 0.17
229 0.14
230 0.15
231 0.13
232 0.13
233 0.13
234 0.09
235 0.09
236 0.08
237 0.08
238 0.06
239 0.08
240 0.08
241 0.12
242 0.14
243 0.2
244 0.22
245 0.22
246 0.22
247 0.2
248 0.23
249 0.22
250 0.19
251 0.15
252 0.17
253 0.21
254 0.22
255 0.24
256 0.23
257 0.22
258 0.23
259 0.23
260 0.2
261 0.19
262 0.22
263 0.24
264 0.25
265 0.26
266 0.28
267 0.32
268 0.34
269 0.4
270 0.43
271 0.45
272 0.48
273 0.48
274 0.48
275 0.45
276 0.46
277 0.43
278 0.41
279 0.36
280 0.34
281 0.32
282 0.29
283 0.27
284 0.24
285 0.21
286 0.19
287 0.21
288 0.24
289 0.26
290 0.31
291 0.36
292 0.4
293 0.42
294 0.48
295 0.55
296 0.59
297 0.67
298 0.73
299 0.78
300 0.82
301 0.87
302 0.83
303 0.82
304 0.8
305 0.75
306 0.73
307 0.65
308 0.57
309 0.48
310 0.44
311 0.37
312 0.36
313 0.33
314 0.25
315 0.28
316 0.28
317 0.27
318 0.26
319 0.25
320 0.16
321 0.17
322 0.18
323 0.12
324 0.16
325 0.2
326 0.26
327 0.29
328 0.31
329 0.36
330 0.44
331 0.51
332 0.56
333 0.61
334 0.58
335 0.58
336 0.6
337 0.58
338 0.55
339 0.57
340 0.55
341 0.54
342 0.51
343 0.5
344 0.55
345 0.51
346 0.48
347 0.44
348 0.42
349 0.43
350 0.51
351 0.58
352 0.56
353 0.64