Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420I8K6

Protein Details
Accession A0A420I8K6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-83LTPFVTKKVWPKRGKFDDPKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MKSTQVLAKRISRLALTTKQTNKGFYKGTGSGSMGEHTKHGGFIIRWEKVRTYVPPENLKDFKLTPFVTKKVWPKRGKFDDPKGAFSGEAYLARWKRENGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.38
4 0.42
5 0.45
6 0.52
7 0.52
8 0.55
9 0.51
10 0.48
11 0.45
12 0.39
13 0.39
14 0.33
15 0.33
16 0.29
17 0.27
18 0.24
19 0.22
20 0.22
21 0.16
22 0.15
23 0.13
24 0.12
25 0.11
26 0.09
27 0.09
28 0.1
29 0.09
30 0.15
31 0.21
32 0.21
33 0.23
34 0.24
35 0.24
36 0.24
37 0.27
38 0.22
39 0.24
40 0.27
41 0.31
42 0.36
43 0.38
44 0.41
45 0.4
46 0.39
47 0.33
48 0.3
49 0.26
50 0.25
51 0.24
52 0.24
53 0.27
54 0.29
55 0.29
56 0.34
57 0.43
58 0.47
59 0.57
60 0.59
61 0.61
62 0.69
63 0.76
64 0.8
65 0.8
66 0.79
67 0.8
68 0.75
69 0.72
70 0.63
71 0.55
72 0.44
73 0.35
74 0.29
75 0.21
76 0.18
77 0.16
78 0.22
79 0.24
80 0.27
81 0.31
82 0.3