Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420I453

Protein Details
Accession A0A420I453    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-107LRIAKARGKAAPKKKKTKEESKKFKGKKKBasic
NLS Segment(s)
PositionSequence
80-107RIAKARGKAAPKKKKTKEESKKFKGKKK
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVARARLLDLLQVQCKVFNTTYNPEGLRLGNKILRQRLRGPSVLAYYPRKVATLQDMNRCLPEWETLDEDEEERLEHLRIAKARGKAAPKKKKTKEESKKFKGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.26
5 0.22
6 0.22
7 0.25
8 0.28
9 0.3
10 0.31
11 0.3
12 0.27
13 0.28
14 0.25
15 0.22
16 0.18
17 0.2
18 0.2
19 0.23
20 0.27
21 0.34
22 0.37
23 0.39
24 0.44
25 0.48
26 0.49
27 0.47
28 0.43
29 0.37
30 0.35
31 0.33
32 0.3
33 0.26
34 0.23
35 0.24
36 0.22
37 0.2
38 0.18
39 0.17
40 0.2
41 0.25
42 0.27
43 0.31
44 0.33
45 0.33
46 0.33
47 0.33
48 0.26
49 0.19
50 0.18
51 0.14
52 0.13
53 0.15
54 0.15
55 0.16
56 0.16
57 0.15
58 0.13
59 0.11
60 0.09
61 0.08
62 0.09
63 0.07
64 0.08
65 0.1
66 0.15
67 0.17
68 0.22
69 0.27
70 0.29
71 0.33
72 0.37
73 0.43
74 0.49
75 0.58
76 0.64
77 0.69
78 0.76
79 0.82
80 0.87
81 0.88
82 0.9
83 0.9
84 0.91
85 0.92
86 0.91
87 0.93