Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420IUB8

Protein Details
Accession A0A420IUB8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
105-130FELVNKMKKNMKKKKKTQLTLELDAPHydrophilic
NLS Segment(s)
PositionSequence
111-120MKKNMKKKKK
Subcellular Location(s) plas 11, E.R. 6, mito 4, extr 2, pero 2, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000440  NADH_UbQ/plastoQ_OxRdtase_su3  
IPR038430  NDAH_ubi_oxred_su3_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0008137  F:NADH dehydrogenase (ubiquinone) activity  
Pfam View protein in Pfam  
PF00507  Oxidored_q4  
Amino Acid Sequences MTATTFFLFLVPILGIVLLLVNLLLAPENAYLEKDNAFECGFSSFLGQNRTQFGISFFVFALLFLLFDLEILLLYPYVVSAYTNGIYGLVIALVFSLVLTLGFAFELVNKMKKNMKKKKKTQLTLELDAPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.03
6 0.03
7 0.03
8 0.02
9 0.02
10 0.03
11 0.03
12 0.03
13 0.04
14 0.05
15 0.06
16 0.06
17 0.08
18 0.09
19 0.1
20 0.1
21 0.1
22 0.1
23 0.11
24 0.11
25 0.1
26 0.09
27 0.1
28 0.09
29 0.08
30 0.1
31 0.1
32 0.13
33 0.17
34 0.17
35 0.17
36 0.19
37 0.2
38 0.19
39 0.17
40 0.16
41 0.16
42 0.15
43 0.14
44 0.12
45 0.11
46 0.11
47 0.1
48 0.09
49 0.05
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.03
59 0.03
60 0.02
61 0.03
62 0.02
63 0.02
64 0.03
65 0.03
66 0.03
67 0.04
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.03
77 0.03
78 0.03
79 0.03
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.08
94 0.1
95 0.15
96 0.16
97 0.2
98 0.27
99 0.35
100 0.46
101 0.54
102 0.63
103 0.69
104 0.79
105 0.87
106 0.91
107 0.92
108 0.91
109 0.91
110 0.88
111 0.83
112 0.77