Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420I7X0

Protein Details
Accession A0A420I7X0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
142-167ASKPELARRQKEKRRKRWEQVIELAEHydrophilic
NLS Segment(s)
PositionSequence
148-158ARRQKEKRRKR
Subcellular Location(s) nucl 12.5, mito_nucl 11, mito 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024974  Sde2_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF13019  Sde2_N_Ubi  
Amino Acid Sequences MSLSTANVLITLFPGLGLPPTISLPVSTETTISQLLSQIFSRLPKLNSRLIITTNSNKQLSHVSSKPISSLLCPTSDLLCLRLGVPLCGGKGGFGSQLRAAGGRMSSKRKRGQGDENDSSRNLDGRRLRTVNEAKALAEYLASKPELARRQKEKRRKRWEQVIELAEIKNFEIKSGNKGRVDGKWVEAKEEASERTRDAVITAMKAGNYKDNLRKVLQKPDTVDQQNIHTSSRDIALTESFPKAITKPPIQRFLGFDEDDTSSDEESEDDDVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.07
6 0.08
7 0.09
8 0.1
9 0.1
10 0.1
11 0.12
12 0.14
13 0.15
14 0.15
15 0.14
16 0.14
17 0.16
18 0.16
19 0.14
20 0.12
21 0.13
22 0.13
23 0.15
24 0.15
25 0.14
26 0.15
27 0.17
28 0.21
29 0.23
30 0.25
31 0.3
32 0.35
33 0.39
34 0.4
35 0.42
36 0.4
37 0.37
38 0.39
39 0.37
40 0.4
41 0.4
42 0.42
43 0.4
44 0.37
45 0.37
46 0.39
47 0.37
48 0.38
49 0.33
50 0.33
51 0.34
52 0.35
53 0.34
54 0.29
55 0.26
56 0.2
57 0.23
58 0.19
59 0.17
60 0.18
61 0.18
62 0.17
63 0.19
64 0.18
65 0.14
66 0.13
67 0.13
68 0.12
69 0.13
70 0.13
71 0.1
72 0.11
73 0.11
74 0.1
75 0.11
76 0.1
77 0.08
78 0.08
79 0.08
80 0.1
81 0.09
82 0.11
83 0.11
84 0.12
85 0.12
86 0.12
87 0.11
88 0.09
89 0.1
90 0.13
91 0.16
92 0.24
93 0.29
94 0.36
95 0.42
96 0.47
97 0.52
98 0.53
99 0.59
100 0.6
101 0.65
102 0.63
103 0.6
104 0.55
105 0.5
106 0.45
107 0.35
108 0.28
109 0.19
110 0.19
111 0.21
112 0.23
113 0.29
114 0.29
115 0.3
116 0.35
117 0.39
118 0.36
119 0.34
120 0.31
121 0.24
122 0.24
123 0.23
124 0.15
125 0.1
126 0.09
127 0.06
128 0.07
129 0.07
130 0.07
131 0.07
132 0.13
133 0.2
134 0.25
135 0.31
136 0.39
137 0.5
138 0.59
139 0.7
140 0.75
141 0.79
142 0.85
143 0.88
144 0.88
145 0.88
146 0.87
147 0.84
148 0.8
149 0.71
150 0.62
151 0.53
152 0.44
153 0.33
154 0.25
155 0.18
156 0.14
157 0.11
158 0.1
159 0.13
160 0.13
161 0.21
162 0.27
163 0.33
164 0.3
165 0.32
166 0.35
167 0.33
168 0.37
169 0.31
170 0.27
171 0.29
172 0.28
173 0.28
174 0.27
175 0.25
176 0.22
177 0.23
178 0.22
179 0.18
180 0.19
181 0.17
182 0.19
183 0.18
184 0.16
185 0.14
186 0.16
187 0.14
188 0.14
189 0.15
190 0.14
191 0.14
192 0.15
193 0.16
194 0.17
195 0.19
196 0.24
197 0.3
198 0.34
199 0.38
200 0.39
201 0.48
202 0.47
203 0.55
204 0.55
205 0.52
206 0.51
207 0.54
208 0.6
209 0.53
210 0.52
211 0.43
212 0.42
213 0.42
214 0.39
215 0.35
216 0.26
217 0.24
218 0.22
219 0.23
220 0.19
221 0.14
222 0.14
223 0.15
224 0.16
225 0.18
226 0.18
227 0.16
228 0.16
229 0.17
230 0.17
231 0.23
232 0.28
233 0.34
234 0.43
235 0.5
236 0.58
237 0.6
238 0.61
239 0.57
240 0.55
241 0.53
242 0.44
243 0.37
244 0.32
245 0.31
246 0.29
247 0.28
248 0.23
249 0.16
250 0.16
251 0.15
252 0.12
253 0.12