Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420JA58

Protein Details
Accession A0A420JA58   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-69VVDCKRFRNKWKYRVKWTGDHydrophilic
86-117AWLFHWKYPNKSKPPNQKIPKNWLPKKEDRDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.833, cyto 10, cyto_pero 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
CDD cd00024  CD_CSD  
Amino Acid Sequences MFNVFHPNLLRLYIPNPIPLQDPPKPKPVKIVPNPNSKDGQDEYLLVNEVVDCKRFRNKWKYRVKWTGDPKYQWEDKENWINHYDAWLFHWKYPNKSKPPNQKIPKNWLPKKEDRDSIKDIAVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.24
4 0.23
5 0.25
6 0.27
7 0.32
8 0.32
9 0.4
10 0.39
11 0.48
12 0.5
13 0.48
14 0.54
15 0.56
16 0.6
17 0.6
18 0.68
19 0.65
20 0.73
21 0.75
22 0.69
23 0.63
24 0.53
25 0.48
26 0.38
27 0.33
28 0.23
29 0.22
30 0.19
31 0.17
32 0.17
33 0.12
34 0.1
35 0.08
36 0.09
37 0.08
38 0.1
39 0.09
40 0.11
41 0.18
42 0.22
43 0.31
44 0.4
45 0.49
46 0.57
47 0.68
48 0.73
49 0.76
50 0.82
51 0.79
52 0.76
53 0.77
54 0.76
55 0.71
56 0.65
57 0.6
58 0.56
59 0.53
60 0.46
61 0.4
62 0.33
63 0.33
64 0.4
65 0.37
66 0.34
67 0.32
68 0.31
69 0.27
70 0.27
71 0.22
72 0.14
73 0.16
74 0.22
75 0.22
76 0.24
77 0.33
78 0.33
79 0.41
80 0.51
81 0.57
82 0.58
83 0.67
84 0.74
85 0.77
86 0.84
87 0.87
88 0.87
89 0.87
90 0.86
91 0.86
92 0.86
93 0.85
94 0.83
95 0.81
96 0.8
97 0.8
98 0.8
99 0.79
100 0.78
101 0.74
102 0.74
103 0.71
104 0.66