Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420J943

Protein Details
Accession A0A420J943   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-93AVTLCCITRRNRQNRRRKKNQGLESSGSHydrophilic
NLS Segment(s)
PositionSequence
78-84QNRRRKK
Subcellular Location(s) nucl 8, plas 6, mito_nucl 6, mito 4, extr 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDFLSNNLPNTPASTLKNTISRRAYGYCVRYGHYGYYSTCRRSIWSRFGRWVLAGILVFLGLIAIAVTLCCITRRNRQNRRRKKNQGLESSGSNYFGGPPPQQQQQYAPPPGAPPKYGGPEPYGGVTQPANAYVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.32
4 0.4
5 0.4
6 0.45
7 0.44
8 0.43
9 0.41
10 0.4
11 0.42
12 0.4
13 0.42
14 0.4
15 0.37
16 0.37
17 0.35
18 0.34
19 0.31
20 0.26
21 0.24
22 0.2
23 0.26
24 0.28
25 0.28
26 0.29
27 0.27
28 0.28
29 0.33
30 0.37
31 0.4
32 0.44
33 0.45
34 0.48
35 0.49
36 0.47
37 0.41
38 0.36
39 0.26
40 0.19
41 0.15
42 0.1
43 0.08
44 0.07
45 0.06
46 0.04
47 0.03
48 0.02
49 0.02
50 0.01
51 0.01
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.06
59 0.1
60 0.19
61 0.29
62 0.4
63 0.51
64 0.61
65 0.72
66 0.81
67 0.88
68 0.91
69 0.92
70 0.92
71 0.91
72 0.91
73 0.89
74 0.84
75 0.76
76 0.67
77 0.6
78 0.5
79 0.4
80 0.31
81 0.22
82 0.17
83 0.16
84 0.16
85 0.14
86 0.18
87 0.2
88 0.27
89 0.29
90 0.29
91 0.31
92 0.37
93 0.44
94 0.42
95 0.39
96 0.34
97 0.36
98 0.41
99 0.4
100 0.32
101 0.27
102 0.3
103 0.34
104 0.35
105 0.34
106 0.3
107 0.3
108 0.3
109 0.29
110 0.25
111 0.19
112 0.2
113 0.18
114 0.16
115 0.15