Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420J852

Protein Details
Accession A0A420J852    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
289-309AEENRLRREKEAKRRRLASMTHydrophilic
NLS Segment(s)
PositionSequence
294-304LRREKEAKRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Amino Acid Sequences MPIGDLLAQITGEPTSNPTHGTSRDMLTPVKRKPEDQTRKLANSSQPSTSSANRSRNLGLPNKPVPLNSSPPKRQNRNVPSAADRNLPASNNNQISPIINSGPSKPPKKGSYAEIMARGKAAHATLGQVGKIMHKNIERPPSKRERDEMKVQKSHKLQKNLTSSSKNQKSGFSKSRDAEKCVPEPPKKIKKAALATTGYTGTARPKASNLSKTSRLSDAKMAQKNFDQNRSSSGPRYRRRSDDYDEDDEEEEEDYETDLSDMEAAAFEVDEEEETAAKIARREDAEALAEENRLRREKEAKRRRLASMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.14
4 0.16
5 0.18
6 0.23
7 0.24
8 0.29
9 0.29
10 0.28
11 0.31
12 0.32
13 0.33
14 0.37
15 0.43
16 0.44
17 0.51
18 0.51
19 0.5
20 0.57
21 0.64
22 0.67
23 0.65
24 0.69
25 0.67
26 0.7
27 0.7
28 0.67
29 0.63
30 0.61
31 0.58
32 0.51
33 0.44
34 0.43
35 0.44
36 0.42
37 0.43
38 0.43
39 0.47
40 0.45
41 0.47
42 0.46
43 0.47
44 0.5
45 0.49
46 0.47
47 0.47
48 0.49
49 0.49
50 0.47
51 0.42
52 0.41
53 0.38
54 0.4
55 0.41
56 0.47
57 0.5
58 0.6
59 0.69
60 0.72
61 0.74
62 0.77
63 0.77
64 0.77
65 0.74
66 0.68
67 0.65
68 0.62
69 0.57
70 0.49
71 0.4
72 0.34
73 0.31
74 0.28
75 0.23
76 0.21
77 0.26
78 0.25
79 0.25
80 0.23
81 0.21
82 0.22
83 0.22
84 0.2
85 0.14
86 0.14
87 0.15
88 0.17
89 0.24
90 0.3
91 0.32
92 0.33
93 0.39
94 0.39
95 0.44
96 0.44
97 0.4
98 0.4
99 0.41
100 0.4
101 0.41
102 0.39
103 0.33
104 0.31
105 0.27
106 0.19
107 0.16
108 0.13
109 0.07
110 0.07
111 0.08
112 0.1
113 0.11
114 0.1
115 0.1
116 0.1
117 0.12
118 0.15
119 0.14
120 0.15
121 0.16
122 0.2
123 0.25
124 0.34
125 0.35
126 0.36
127 0.43
128 0.49
129 0.52
130 0.51
131 0.52
132 0.49
133 0.5
134 0.58
135 0.6
136 0.57
137 0.59
138 0.57
139 0.58
140 0.58
141 0.62
142 0.58
143 0.57
144 0.52
145 0.54
146 0.6
147 0.58
148 0.57
149 0.52
150 0.5
151 0.52
152 0.55
153 0.52
154 0.45
155 0.47
156 0.47
157 0.51
158 0.54
159 0.49
160 0.48
161 0.46
162 0.54
163 0.51
164 0.52
165 0.5
166 0.46
167 0.44
168 0.43
169 0.49
170 0.43
171 0.48
172 0.52
173 0.56
174 0.56
175 0.58
176 0.57
177 0.58
178 0.61
179 0.59
180 0.56
181 0.48
182 0.44
183 0.42
184 0.36
185 0.28
186 0.21
187 0.17
188 0.13
189 0.15
190 0.16
191 0.14
192 0.16
193 0.23
194 0.28
195 0.35
196 0.37
197 0.39
198 0.45
199 0.46
200 0.48
201 0.47
202 0.43
203 0.38
204 0.4
205 0.41
206 0.43
207 0.47
208 0.45
209 0.41
210 0.42
211 0.49
212 0.47
213 0.47
214 0.41
215 0.36
216 0.4
217 0.43
218 0.42
219 0.4
220 0.45
221 0.48
222 0.54
223 0.62
224 0.63
225 0.65
226 0.7
227 0.7
228 0.68
229 0.68
230 0.66
231 0.64
232 0.59
233 0.53
234 0.47
235 0.4
236 0.33
237 0.24
238 0.17
239 0.11
240 0.09
241 0.08
242 0.07
243 0.07
244 0.06
245 0.05
246 0.05
247 0.05
248 0.05
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.05
257 0.05
258 0.05
259 0.06
260 0.06
261 0.06
262 0.07
263 0.09
264 0.1
265 0.12
266 0.13
267 0.18
268 0.2
269 0.23
270 0.25
271 0.26
272 0.27
273 0.25
274 0.26
275 0.22
276 0.21
277 0.2
278 0.22
279 0.25
280 0.26
281 0.27
282 0.31
283 0.41
284 0.49
285 0.59
286 0.66
287 0.71
288 0.77
289 0.81